Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human EBI3 Monoclonal Antibody | anti-EBI3 antibody

EBI3 (IL27B, Interleukin-27 Subunit beta, Epstein-Barr Virus-induced Gene 3 Protein) (MaxLight 550)

Gene Names
EBI3; IL27B; IL-27B
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EBI3; Monoclonal Antibody; EBI3 (IL27B; Interleukin-27 Subunit beta; Epstein-Barr Virus-induced Gene 3 Protein) (MaxLight 550); anti-EBI3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D3
Specificity
Recognizes human EBI3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-EBI3 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa129-229 from EBI3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EBI3 antibody
This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28kD protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
Product Categories/Family for anti-EBI3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,396 Da
NCBI Official Full Name
interleukin-27 subunit beta
NCBI Official Synonym Full Names
Epstein-Barr virus induced 3
NCBI Official Symbol
EBI3
NCBI Official Synonym Symbols
IL27B; IL-27B
NCBI Protein Information
interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein
UniProt Protein Name
Interleukin-27 subunit beta
Protein Family
UniProt Gene Name
EBI3
UniProt Synonym Gene Names
IL27B; IL-27 subunit beta; IL-27B; EBV-induced gene 3 protein
UniProt Entry Name
IL27B_HUMAN

NCBI Description

This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008]

Uniprot Description

IL27-beta: Cytokine with pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. Belongs to the type I cytokine receptor family. Type 3 subfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; interleukin-27 receptor binding; cytokine activity

Biological Process: T-helper 1 type immune response; cytokine and chemokine mediated signaling pathway; positive regulation of alpha-beta T cell proliferation; humoral immune response; positive regulation of interferon-gamma biosynthetic process

Research Articles on EBI3

Similar Products

Product Notes

The EBI3 ebi3 (Catalog #AAA6211260) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EBI3 (IL27B, Interleukin-27 Subunit beta, Epstein-Barr Virus-induced Gene 3 Protein) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EBI3 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EBI3 ebi3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EBI3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.