Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CNOT8 Monoclonal Antibody | anti-CNOT8 antibody

CNOT8 (CCR4-NOT Transcription Complex Subunit 8, CCR4-associated Factor 8, CAF1-like Protein, CALIFp, CAF2, POP2, CALIF) (MaxLight 550)

Gene Names
CNOT8; CAF1; POP2; CALIF; Caf1b; hCAF1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CNOT8; Monoclonal Antibody; CNOT8 (CCR4-NOT Transcription Complex Subunit 8; CCR4-associated Factor 8; CAF1-like Protein; CALIFp; CAF2; POP2; CALIF) (MaxLight 550); anti-CNOT8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F11
Specificity
Recognizes human CNOT8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CNOT8 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-292 from CNOT8 (NP_004770) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CNOT8 antibody
Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.
Product Categories/Family for anti-CNOT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9 kDa (315aa), confirmed by MALDI-TOF
NCBI Official Full Name
CCR4-NOT transcription complex subunit 8 isoform 1
NCBI Official Synonym Full Names
CCR4-NOT transcription complex subunit 8
NCBI Official Symbol
CNOT8
NCBI Official Synonym Symbols
CAF1; POP2; CALIF; Caf1b; hCAF1
NCBI Protein Information
CCR4-NOT transcription complex subunit 8
UniProt Protein Name
CCR4-NOT transcription complex subunit 8
UniProt Gene Name
CNOT8
UniProt Synonym Gene Names
CALIF; POP2; CALIFp
UniProt Entry Name
CNOT8_HUMAN

Uniprot Description

CNOT8: Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex. Belongs to the CAF1 family.

Protein type: EC 3.1.13.4

Chromosomal Location of Human Ortholog: 5q31-q33

Cellular Component: intracellular; cytosol; nucleus; CCR4-NOT complex

Molecular Function: protein binding; 3'-5'-exoribonuclease activity; poly(A)-specific ribonuclease activity; RNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of translation; negative regulation of cell proliferation; poly(A) tail shortening; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of cell proliferation; gene expression; miRNA-mediated gene silencing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on CNOT8

Similar Products

Product Notes

The CNOT8 cnot8 (Catalog #AAA6210880) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CNOT8 (CCR4-NOT Transcription Complex Subunit 8, CCR4-associated Factor 8, CAF1-like Protein, CALIFp, CAF2, POP2, CALIF) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNOT8 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CNOT8 cnot8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNOT8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.