Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse PPARGC1A Monoclonal Antibody | anti-PPARGC1A antibody

PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 490)

Gene Names
PPARGC1A; LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1(alpha)
Applications
Western Blot
Purity
Purified
Synonyms
PPARGC1A; Monoclonal Antibody; PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma; Coactivator 1 alpha; LEM6; PGC-1(alpha); PGC-1v; PGC1; PGC1A; PPARGC1) (MaxLight 490); Peroxisome Proliferator-Activated Receptor gamma; PPARGC1; anti-PPARGC1A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G11
Specificity
Recognizes PPARGC1A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-PPARGC1A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PPARGC1A (NP_037393, 689aa-798aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PPARGC1A antibody
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq]
Product Categories/Family for anti-PPARGC1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted: 88 kDa

Observed: 99 kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor gamma coactivator 1-alpha
NCBI Official Synonym Full Names
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
NCBI Official Symbol
PPARGC1A
NCBI Official Synonym Symbols
LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1(alpha)
NCBI Protein Information
peroxisome proliferator-activated receptor gamma coactivator 1-alpha; PGC-1-alpha; L-PGC-1alpha; PPARGC-1-alpha; ligand effect modulator-6; PPAR gamma coactivator variant form; peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcrip
UniProt Protein Name
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
UniProt Gene Name
PPARGC1A
UniProt Synonym Gene Names
LEM6; PGC1; PGC1A; PPARGC1; PGC-1-alpha; PPAR-gamma coactivator 1-alpha
UniProt Entry Name
PRGC1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq, Jul 2008]

Research Articles on PPARGC1A

Similar Products

Product Notes

The PPARGC1A ppargc1a (Catalog #AAA6208010) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PPARGC1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPARGC1A ppargc1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPARGC1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.