Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NME4 Monoclonal Antibody | anti-NME4 antibody

NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (MaxLight 490)

Gene Names
NME4; NDPK-D; NM23H4; nm23-H4
Applications
Western Blot
Purity
Purified
Synonyms
NME4; Monoclonal Antibody; NME4 (Non-Metastatic Cells 4; Protein Expressed in; NDPK-D; NM23H4; nm23-H4) (MaxLight 490); Non-Metastatic Cells 4; nm23-H4; anti-NME4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B6
Specificity
Recognizes NME4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-NME4 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NME4 (NP_005000.1, 99aa-187aa) partial recombinant protein with GST tag.
Immunogen Sequence
RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NME4 antibody
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Alternative splice variants encoding the same protein have been identified at this locus. [provided by RefSeq]
Product Categories/Family for anti-NME4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,659 Da
NCBI Official Full Name
nucleoside diphosphate kinase, mitochondrial
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 4
NCBI Official Symbol
NME4
NCBI Official Synonym Symbols
NDPK-D; NM23H4; nm23-H4
NCBI Protein Information
nucleoside diphosphate kinase, mitochondrial; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; non-metastatic cells 4, protein expressed in
UniProt Protein Name
Nucleoside diphosphate kinase, mitochondrial
UniProt Gene Name
NME4
UniProt Synonym Gene Names
NM23D; NDK; NDP kinase, mitochondrial; NDPKD
UniProt Entry Name
NDKM_HUMAN

NCBI Description

The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]

Uniprot Description

NME4: Major role in the synthesis of nucleoside triphosphates other than ATP. Belongs to the NDK family.

Protein type: Kinase, other; Nucleotide Metabolism - purine; EC 2.7.4.6; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; Mitochondrial; Other group; NDK family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol

Molecular Function: protein binding; metal ion binding; nucleoside diphosphate kinase activity; protein complex binding; ATP binding

Biological Process: regulation of apoptosis; GTP biosynthetic process; CTP biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside metabolic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process

Research Articles on NME4

Similar Products

Product Notes

The NME4 nme4 (Catalog #AAA6207619) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NME4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NME4 nme4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NME4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.