Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse EPHA5 Monoclonal Antibody | anti-EPHA5 antibody

EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4) (MaxLight 490)

Gene Names
EPHA5; EK7; CEK7; EHK1; HEK7; EHK-1; TYRO4
Applications
Western Blot
Purity
Purified
Synonyms
EPHA5; Monoclonal Antibody; EPHA5 (EPH Receptor A5; CEK7; EHK1; HEK7; TYRO4) (MaxLight 490); EPH Receptor A5; TYRO4; anti-EPHA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F4
Specificity
Recognizes EPHA5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-EPHA5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EPHA5 (NP_004430, 234aa-333aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EPHA5 antibody
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-EPHA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107,699 Da
NCBI Official Full Name
ephrin type-A receptor 5 isoform a
NCBI Official Synonym Full Names
EPH receptor A5
NCBI Official Symbol
EPHA5
NCBI Official Synonym Symbols
EK7; CEK7; EHK1; HEK7; EHK-1; TYRO4
NCBI Protein Information
ephrin type-A receptor 5
UniProt Protein Name
Ephrin type-A receptor 5
Protein Family
UniProt Gene Name
EPHA5
UniProt Synonym Gene Names
BSK; EHK1; HEK7; TYRO4; EHK-1; EK7; hEK7
UniProt Entry Name
EPHA5_HUMAN

NCBI Description

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

Uniprot Description

EphA5: Receptor tyrosine kinase which binds promiscuously GPI- anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino- hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. Beside its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; EC 2.7.10.1; TK group; Eph family

Chromosomal Location of Human Ortholog: 4q13.1

Cellular Component: rough endoplasmic reticulum; cell soma; axon; perinuclear region of cytoplasm; integral to plasma membrane; dendrite; plasma membrane; external side of plasma membrane

Molecular Function: transmembrane-ephrin receptor activity; GPI-linked ephrin receptor activity; ephrin receptor activity; ATP binding

Biological Process: axon guidance; cAMP-mediated signaling; peptidyl-tyrosine phosphorylation; regulation of actin cytoskeleton organization and biogenesis; hippocampus development; activation of CREB transcription factor; ephrin receptor signaling pathway; neuron development

Research Articles on EPHA5

Similar Products

Product Notes

The EPHA5 epha5 (Catalog #AAA6206047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EPHA5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPHA5 epha5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPHA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.