Mouse anti-Human PIBF1 Monoclonal Antibody | anti-PIBF1 antibody
PIBF1 (Progesterone-induced Blocking Factor 1, PIBF, Chromosome 13 Open Reading Frame 24, C13orf24, KIAA1008, Progesterone Immunomodulatory Binding Factor 1, RP11-505F3.1) (MaxLight 490)
Gene Names
PIBF1; PIBF; CEP90; C13orf24
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIBF1; Monoclonal Antibody; PIBF1 (Progesterone-induced Blocking Factor 1; PIBF; Chromosome 13 Open Reading Frame 24; C13orf24; KIAA1008; Progesterone Immunomodulatory Binding Factor 1; RP11-505F3.1) (MaxLight 490); anti-PIBF1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7B7
Specificity
Recognizes human C13orf24.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-PIBF1 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa660-755 from C13orf24 (NP_006337) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PIBF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83 kDa
NCBI Official Full Name
AV194806 Yuji Kohara unpublished cDNA:Strain N2 hermaphrodite embryo Caenorhabditis elegans cDNA clone yk634a12 5-, mRNA sequence
NCBI Official Synonym Full Names
progesterone immunomodulatory binding factor 1
NCBI Official Symbol
PIBF1
NCBI Official Synonym Symbols
PIBF; CEP90; C13orf24
NCBI Protein Information
progesterone-induced-blocking factor 1; progesterone-induced blocking factor 1
UniProt Protein Name
Progesterone-induced-blocking factor 1
Protein Family
UniProt Gene Name
PIBF1
UniProt Synonym Gene Names
C13orf24; PIBF
UniProt Entry Name
PIBF1_HUMAN
Uniprot Description
PIBF1: Mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling NK activity exerts an anti-abortive effect. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 13q22.1
Cellular Component: centrosome
Molecular Function: protein binding
Research Articles on PIBF1
Similar Products
Product Notes
The PIBF1 pibf1 (Catalog #AAA6202478) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIBF1 (Progesterone-induced Blocking Factor 1, PIBF, Chromosome 13 Open Reading Frame 24, C13orf24, KIAA1008, Progesterone Immunomodulatory Binding Factor 1, RP11-505F3.1) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIBF1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIBF1 pibf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIBF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
