Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human IKBKAP Monoclonal Antibody | anti-IKBKAP antibody

IKBKAP (Elongator Complex Protein 1, ELP1, IkappaB Kinase Complex-associated Protein, IKK Complex-associated Protein, p150, ELP1, IKAP, DKFZp781H1425, DYS, FLJ12497) (MaxLight 490)

Gene Names
IKBKAP; FD; DYS; ELP1; IKAP; IKI3; TOT1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IKBKAP; Monoclonal Antibody; IKBKAP (Elongator Complex Protein 1; ELP1; IkappaB Kinase Complex-associated Protein; IKK Complex-associated Protein; p150; IKAP; DKFZp781H1425; DYS; FLJ12497) (MaxLight 490); anti-IKBKAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6G9
Specificity
Recognizes human IKBKAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-IKBKAP antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1242-1332 from IKBKAP (NP_003631) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-IKBKAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
150,254 Da
NCBI Official Full Name
elongator complex protein 1
NCBI Official Synonym Full Names
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
NCBI Official Symbol
IKBKAP
NCBI Official Synonym Symbols
FD; DYS; ELP1; IKAP; IKI3; TOT1
NCBI Protein Information
elongator complex protein 1; IKK complex-associated protein; elongator acetyltransferase complex subunit 1; ikappaB kinase complex-associated protein; p150
UniProt Protein Name
Elongator complex protein 1
UniProt Gene Name
IKBKAP
UniProt Synonym Gene Names
ELP1; IKAP; ELP1; IKK complex-associated protein
UniProt Entry Name
ELP1_HUMAN

Uniprot Description

IKBKAP: May act as a scaffold protein that may assemble active IKK-MAP3K14 complexes (IKKA, IKKB and MAP3K14/NIK). Interacts preferentially with MAP3K14/NIK followed by IKK-alpha and IKK-beta. Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, and two yet unidentified proteins, p30 and p38. Elongator associates with the C-terminal domain (CTD) of Pol II largest subunit. Interacts with ELP3. Belongs to the ELP1/IKA1 family.

Protein type: Protein kinase, regulatory subunit; Transcription regulation

Chromosomal Location of Human Ortholog: 9q31

Cellular Component: transcription elongation factor complex; Elongator holoenzyme complex; cytoplasm; nucleolus; histone acetyltransferase complex

Molecular Function: protein binding; signal transducer activity; phosphorylase kinase regulator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; RNA elongation from RNA polymerase II promoter; immune response; protein complex assembly; signal transduction; regulation of protein kinase activity; protein amino acid phosphorylation; positive regulation of cell migration

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type Iii

Similar Products

Product Notes

The IKBKAP ikbkap (Catalog #AAA6201369) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IKBKAP (Elongator Complex Protein 1, ELP1, IkappaB Kinase Complex-associated Protein, IKK Complex-associated Protein, p150, ELP1, IKAP, DKFZp781H1425, DYS, FLJ12497) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IKBKAP can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IKBKAP ikbkap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IKBKAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.