Mouse anti-Human IKBKAP Monoclonal Antibody | anti-IKBKAP antibody

IKBKAP (Elongator Complex Protein 1, ELP1, IkappaB Kinase Complex-associated Protein, IKK Complex-associated Protein, p150, ELP1, IKAP, DKFZp781H1425, DYS, FLJ12497) (PE)

Cat. Num. AAA6158346

• Gene Names: IKBKAP; FD; DYS; ELP1; IKAP; IKI3; TOT1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IKBKAP; Monoclonal Antibody; IKBKAP (Elongator Complex Protein 1; ELP1; IkappaB Kinase Complex-associated Protein; IKK Complex-associated Protein; p150; IKAP; DKFZp781H1425; DYS; FLJ12497) (PE); anti-IKBKAP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6G9
• Specificity: Recognizes human IKBKAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IKBKAP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1242-1332 from IKBKAP (NP_003631) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(IKBKAP monoclonal antibody Western Blot analysis of IKBKAP expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IKBKAP on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged IKBKAP is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-IKBKAP antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 38569394
• NCBI GeneID: 8518
• NCBI Accession #: NP_003631
• NCBI GenBank Nucleotide #: NM_003640
• UniProt Accession #: O95163; Q5JSV2; Q9H327; Q9UG87
• Molecular Weight: 150,254 Da
• NCBI Official Full Name: elongator complex protein 1
• NCBI Official Synonym Full Names: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
• NCBI Official Symbol: IKBKAP
• NCBI Official Synonym Symbols: FD; DYS; ELP1; IKAP; IKI3; TOT1
• NCBI Protein Information: elongator complex protein 1; IKK complex-associated protein; elongator acetyltransferase complex subunit 1; ikappaB kinase complex-associated protein; p150
• UniProt Protein Name: Elongator complex protein 1
• UniProt Gene Name: IKBKAP
• UniProt Synonym Gene Names: ELP1; IKAP; ELP1; IKK complex-associated protein
• UniProt Entry Name: ELP1_HUMAN

Uniprot Description

IKBKAP: May act as a scaffold protein that may assemble active IKK-MAP3K14 complexes (IKKA, IKKB and MAP3K14/NIK). Interacts preferentially with MAP3K14/NIK followed by IKK-alpha and IKK-beta. Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, and two yet unidentified proteins, p30 and p38. Elongator associates with the C-terminal domain (CTD) of Pol II largest subunit. Interacts with ELP3. Belongs to the ELP1/IKA1 family.

Protein type: Protein kinase, regulatory subunit; Transcription regulation

Chromosomal Location of Human Ortholog: 9q31

Cellular Component: transcription elongation factor complex; Elongator holoenzyme complex; cytoplasm; nucleolus; histone acetyltransferase complex

Molecular Function: protein binding; signal transducer activity; phosphorylase kinase regulator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; RNA elongation from RNA polymerase II promoter; immune response; protein complex assembly; signal transduction; regulation of protein kinase activity; protein amino acid phosphorylation; positive regulation of cell migration

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type Iii