Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NUCB2 Monoclonal Antibody | anti-NUCB2 antibody

NUCB2 (nucleobindin 2, NEFA) (MaxLight 405)

Gene Names
NUCB2; NEFA; HEL-S-109
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
NUCB2; Monoclonal Antibody; NUCB2 (nucleobindin 2; NEFA) (MaxLight 405); nucleobindin 2; NEFA; anti-NUCB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6H4
Specificity
Recognizes NUCB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-NUCB2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NUCB2 (NP_005004.1, 322aa-420aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NUCB2 antibody
Nucleobindin-2 is a calcium-binding EF-hand protein. [supplied by OMIM]
Product Categories/Family for anti-NUCB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,196 Da
NCBI Official Full Name
nucleobindin-2
NCBI Official Synonym Full Names
nucleobindin 2
NCBI Official Symbol
NUCB2
NCBI Official Synonym Symbols
NEFA; HEL-S-109
NCBI Protein Information
nucleobindin-2; nesfatin-1; prepronefastin; prepronesfatin; nucleobinding 2; DNA-binding protein NEFA; gastric cancer antigen Zg4; epididymis secretory protein Li 109
UniProt Protein Name
Nucleobindin-2
Protein Family
UniProt Gene Name
NUCB2
UniProt Synonym Gene Names
NEFA
UniProt Entry Name
NUCB2_HUMAN

NCBI Description

This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]

Uniprot Description

NUCB2: Calcium-binding protein. May have a role in calcium homeostasis. Belongs to the nucleobindin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Vesicle

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: Golgi apparatus; extracellular space; endoplasmic reticulum; plasma membrane; ER-Golgi intermediate compartment; nuclear envelope; cytosol

Molecular Function: protein binding; DNA binding; calcium ion binding

Research Articles on NUCB2

Similar Products

Product Notes

The NUCB2 nucb2 (Catalog #AAA6197020) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NUCB2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUCB2 nucb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUCB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.