Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IRF5 monoclonal antibody (M03), clone 1H6 Western Blot analysis of IRF5 expression in A-431.)

Mouse IRF5 Monoclonal Antibody | anti-IRF5 antibody

IRF5 (Interferon Regulatory Factor 5, SLEB10) (Biotin)

Gene Names
IRF5; SLEB10
Applications
Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
IRF5; Monoclonal Antibody; IRF5 (Interferon Regulatory Factor 5; SLEB10) (Biotin); Interferon Regulatory Factor 5; SLEB10; anti-IRF5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H6
Specificity
Recognizes IRF5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-IRF5 antibody
Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IRF5 (NP_002191, 395aa-504aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IRF5 monoclonal antibody (M03), clone 1H6 Western Blot analysis of IRF5 expression in A-431.)

Western Blot (WB) (IRF5 monoclonal antibody (M03), clone 1H6 Western Blot analysis of IRF5 expression in A-431.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IRF5 on A-431 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to IRF5 on A-431 cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IRF5 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IRF5 is approximately 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(IRF5 monoclonal antibody (M03), clone 1H6. Western Blot analysis of IRF5 expression in NIH/3T3.)

Western Blot (WB) (IRF5 monoclonal antibody (M03), clone 1H6. Western Blot analysis of IRF5 expression in NIH/3T3.)

Immunoprecipitation (IP)

(Immunoprecipitation of IRF5 transfected lysate using anti-IRF5 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with IRF5 MaxPab mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of IRF5 transfected lysate using anti-IRF5 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with IRF5 MaxPab mouse polyclonal antibody.)
Related Product Information for anti-IRF5 antibody
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative splice variants encoding different isoforms exist. [provided by RefSeq]
Product Categories/Family for anti-IRF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,020 Da
NCBI Official Synonym Full Names
interferon regulatory factor 5
NCBI Official Symbol
IRF5
NCBI Official Synonym Symbols
SLEB10
NCBI Protein Information
interferon regulatory factor 5

NCBI Description

This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016]

Research Articles on IRF5

Similar Products

Product Notes

The IRF5 (Catalog #AAA6170443) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IRF5 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRF5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRF5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.