Mouse anti-Human SORL1 Monoclonal Antibody | anti-SORL1 antibody
SORL1 (Sortilin-related Receptor, Low-density Lipoprotein Receptor Relative with 11 Ligand-binding Repeats, LDLR Relative with 11 Ligand-binding Repeats, LR11, SorLA-1, Sorting Protein-related Receptor Containing LDLR class A Repeats, C11orf32) (MaxLight
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SORL1; Monoclonal Antibody; SORL1 (Sortilin-related Receptor; Low-density Lipoprotein Receptor Relative with 11 Ligand-binding Repeats; LDLR Relative with 11 Ligand-binding Repeats; LR11; SorLA-1; Sorting Protein-related Receptor Containing LDLR class A Repeats; C11orf32) (MaxLight; anti-SORL1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F2
Specificity
Recognizes human SORL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
2214
Applicable Applications for anti-SORL1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa82-182 from human SORL1 (NP_003096) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SORL1 antibody
SORL1 is likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. It binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. SORL1 binds the receptor-associated protein (RAP). It could play a role in cell-cell interaction. SORL1 is expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. It is also found in spinal cord, testis, liver, kidney and pancreas with detectable levels in placenta, lung and heart. Moreover, it is expressed in the prostate, ovary, thyroid and spleen, but not found in kidney, liver, lung, skeletal muscle, bone marrow and adrenals.
Product Categories/Family for anti-SORL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
sortilin-related receptor preproprotein
Protein Family
Similar Products
Product Notes
The SORL1 (Catalog #AAA6192790) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SORL1 (Sortilin-related Receptor, Low-density Lipoprotein Receptor Relative with 11 Ligand-binding Repeats, LDLR Relative with 11 Ligand-binding Repeats, LR11, SorLA-1, Sorting Protein-related Receptor Containing LDLR class A Repeats, C11orf32) (MaxLight reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SORL1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SORL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SORL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
