Mouse anti-Human S100A8 Monoclonal Antibody | anti-S100A8 antibody

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF

Cat. Num. AAA6192455

• Gene Names: S100A8; P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: S100A8; Monoclonal Antibody; S100A8 (S100 Calcium Binding Protein A8; 60B8AG; Calgranulin-A; CAGA; CGLA; Calprotectin L1L Subunit; CP-10; Cystic Fibrosis Antigen; CFAG; L1Ag; Leukocyte L1 Complex Light Chain; MA387; MIF; Migration Inhibitory Factor-related Protein 8; MRP8; MRP-8; NIF; anti-S100A8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H2
• Specificity: Recognizes human S100A8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

• Applicable Applications for anti-S100A8 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-94 from human S100AB (AH05928) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE*
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-S100A8 antibody

S100 Calcium Binding Protein A8 (S100A8) is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A8 may function in the inhibition of casein kinase and as a cytokine. Altered expression of S100A8 is associated with the disease cystic fibrosis.

Product Categories/Family for anti-S100A8 antibody

Antibodies; Binding Proteins; Calcium

NCBI and Uniprot Product Information

• NCBI GI #: 34782940
• NCBI GeneID: 6279
• Molecular Weight: 10,835 Da
• NCBI Official Full Name: Homo sapiens S100 calcium binding protein A8, mRNA
• NCBI Official Synonym Full Names: S100 calcium binding protein A8
• NCBI Official Symbol: S100A8
• NCBI Official Synonym Symbols: P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
• NCBI Protein Information: protein S100-A8
• Protein Family: Protein

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]