Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PTPLAD1 Monoclonal Antibody | anti-PTPLAD1 antibody

PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1, Protein Tyrosine Phosphatase-like Protein PTPLAD1, Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3, 3-hydroxyacyl-CoA Dehydratase 3, HACD3, Butyrate-induced

Gene Names
HACD3; BIND1; B-IND1; HSPC121; PTPLAD1
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTPLAD1; Monoclonal Antibody; PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1; Protein Tyrosine Phosphatase-like Protein PTPLAD1; Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3; 3-hydroxyacyl-CoA Dehydratase 3; HACD3; Butyrate-induced; EC=4.2.1.134; FLJ90376; anti-PTPLAD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B5
Specificity
Recognizes human PTPLAD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PTPLAD1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-114 from human PTPLAD1 (NP_057479) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PTPLAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
NCBI Official Synonym Full Names
3-hydroxyacyl-CoA dehydratase 3
NCBI Official Symbol
HACD3
NCBI Official Synonym Symbols
BIND1; B-IND1; HSPC121; PTPLAD1
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3
UniProt Gene Name
PTPLAD1
UniProt Synonym Gene Names
BIND1; HACD3; HACD3; B-ind1; hB-ind1
UniProt Entry Name
HACD3_HUMAN

Uniprot Description

Function: Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. Involved in Rac1-signaling pathways leading to the modulation of gene expression. Ref.1 Ref.8

Catalytic activity: A very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] = a very-long-chain trans-2,3-dehydroacyl-[acyl-carrier protein] + H2O. Ref.8

Subunit structure: Interacts with the condensation enzymes of the ELOVL family. Interacts with RAC1. Ref.1 Ref.8

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.8.

Tissue specificity: Highly expressed in testis, kidney, brain, liver and weakly in skeletal muscle, spleen and heart. No expression detected in leukocytes. Ref.1 Ref.8

Induction: By AKAP12 and histone deacetylase inhibitors such as sodium butyrate. Ref.6

Sequence similarities: Belongs to the very long-chain fatty acids dehydratase HACD family.Contains 1 CS domain.

Sequence caution: The sequence AAF29085.1 differs from that shown. Reason: Frameshift at position 356. The sequence BAC11249.1 differs from that shown. Reason: Frameshift at position 359.

Research Articles on PTPLAD1

Similar Products

Product Notes

The PTPLAD1 ptplad1 (Catalog #AAA6192082) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1, Protein Tyrosine Phosphatase-like Protein PTPLAD1, Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3, 3-hydroxyacyl-CoA Dehydratase 3, HACD3, Butyrate-induced reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPLAD1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPLAD1 ptplad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPLAD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.