Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CYLN2 Monoclonal Antibody | anti-CYLN2 antibody

CYLN2 (CAP-Gly Domain-containing Linker Protein 2, Cytoplasmic Linker Protein 115, CLIP-115, Cytoplasmic Linker Protein 2, Williams-Beuren Syndrome Chromosomal Region 3 Protein, Williams-Beuren Syndrome Chromosomal Region 4 Protein, CLIP2, KIAA0291, WBSCR

Gene Names
CLIP2; CLIP; CYLN2; WSCR3; WSCR4; WBSCR3; WBSCR4; CLIP-115
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYLN2; Monoclonal Antibody; CYLN2 (CAP-Gly Domain-containing Linker Protein 2; Cytoplasmic Linker Protein 115; CLIP-115; Cytoplasmic Linker Protein 2; Williams-Beuren Syndrome Chromosomal Region 3 Protein; Williams-Beuren Syndrome Chromosomal Region 4 Protein; CLIP2; KIAA0291; WBSCR; anti-CYLN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H5
Specificity
Recognizes human CYLN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CYLN2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa946-1046 from human CYLN2 (NP_003379) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CYLN2 antibody
The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.
Product Categories/Family for anti-CYLN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116 kDa
NCBI Official Full Name
CAP-Gly domain-containing linker protein 2 isoform 1
NCBI Official Synonym Full Names
CAP-Gly domain containing linker protein 2
NCBI Official Symbol
CLIP2
NCBI Official Synonym Symbols
CLIP; CYLN2; WSCR3; WSCR4; WBSCR3; WBSCR4; CLIP-115
NCBI Protein Information
CAP-Gly domain-containing linker protein 2
UniProt Protein Name
CAP-Gly domain-containing linker protein 2
UniProt Gene Name
CLIP2
UniProt Synonym Gene Names
CYLN2; KIAA0291; WBSCR3; WBSCR4; WSCR4; CLIP-115
UniProt Entry Name
CLIP2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

CYLN2: Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operate in the control of brain-specific organelle translocations. CLIP2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of CLIP2 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: microtubule associated complex; cytoplasmic microtubule

Molecular Function: microtubule plus-end binding

Research Articles on CYLN2

Similar Products

Product Notes

The CYLN2 clip2 (Catalog #AAA6189696) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYLN2 (CAP-Gly Domain-containing Linker Protein 2, Cytoplasmic Linker Protein 115, CLIP-115, Cytoplasmic Linker Protein 2, Williams-Beuren Syndrome Chromosomal Region 3 Protein, Williams-Beuren Syndrome Chromosomal Region 4 Protein, CLIP2, KIAA0291, WBSCR reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYLN2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYLN2 clip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYLN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.