Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CD142 Monoclonal Antibody | anti-CD142 antibody

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 405)

Gene Names
F3; TF; TFA; CD142
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD142; Monoclonal Antibody; CD142 (CD142 Antigen; Coagulation Factor III; F3; Tissue Factor; TF; TFA; Thromboplastin) (MaxLight 405); anti-CD142 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Specificity
Recognizes human F3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CD142 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa45-154 from human F3 (AAH11029) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CD142 antibody
CD142, a 45kD cell surface glycoprotein which is also known as Tissue Factor. CD142 expression can be induced on monocytes, macrophages and endothelial cells by various stimuli including interleukin 1, tumor necrosis factor and endotoxin. CD142 initiates the blood clotting cascade by binding coagulation Factor VIIa, which activates Factor IX or Factor X by specific limited proteolysis. CD142 also plays an important role in inflammation, angiogenesis, and the pathophysiology of atherosclerosis and cancer.
Product Categories/Family for anti-CD142 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
27,145 Da
NCBI Official Full Name
Homo sapiens coagulation factor III (thromboplastin, tissue factor), mRNA
NCBI Official Synonym Full Names
coagulation factor III, tissue factor
NCBI Official Symbol
F3
NCBI Official Synonym Symbols
TF; TFA; CD142
NCBI Protein Information
tissue factor

NCBI Description

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Research Articles on CD142

Similar Products

Product Notes

The CD142 (Catalog #AAA6189288) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD142 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD142 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD142, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.