Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AXIN1 Monoclonal Antibody | anti-AXIN1 antibody

AXIN1 (Axin 1, Axin-1, AXIN, Axis Inhibition Protein 1, hAxin, MGC52315) (MaxLight 405)

Gene Names
AXIN1; AXIN; PPP1R49
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AXIN1; Monoclonal Antibody; AXIN1 (Axin 1; Axin-1; AXIN; Axis Inhibition Protein 1; hAxin; MGC52315) (MaxLight 405); anti-AXIN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B11
Specificity
Recognizes human AXIN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-AXIN1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa643-741 from AXIN1 (NP_003493) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-AXIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91,653 Da
NCBI Official Full Name
axin-1 isoform a
NCBI Official Synonym Full Names
axin 1
NCBI Official Symbol
AXIN1
NCBI Official Synonym Symbols
AXIN; PPP1R49
NCBI Protein Information
axin-1; axis inhibition protein 1; axis inhibitor 1; fused, mouse, homolog of; protein phosphatase 1, regulatory subunit 49
UniProt Protein Name
Axin-1
Protein Family
UniProt Gene Name
AXIN1
UniProt Synonym Gene Names
AXIN; hAxin
UniProt Entry Name
AXIN1_HUMAN

Uniprot Description

axin 1: is a negative regulator of the Wnt pathway, which is critical in stem cell signaling, morphogenesis, the mesenchymal-epithelial transition, and many cancers. Axin-1 functions as a tumor suppressor. Probably facilitates the phosphorylation of beta-catenin and APC by GSK3B, leading to their ubiquitination and subsequent proteolysis. Wild-type axin 1 can induce apoptosis in hepatocellular and colorectal cancer cells. Is downregulated during progression of esophageal squamous cell carcinoma. Mutation of the axin-1 gene is associated with hepatocellular carcinoma, anaplastic thyroid cancer, medulloblastoma and colorectal cancer. May have a role in oncogenesis in Hodgkin lymphoma. Axin1/2 mediate cross-talk between TGF-beta and Wnt signaling pathways.

Protein type: Tumor suppressor; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; cytoplasmic microtubule; cytoplasmic membrane-bound vesicle; postsynaptic density; cytoplasm; cell cortex; cytoplasmic vesicle; cytosol; beta-catenin destruction complex; nucleus; lateral plasma membrane

Molecular Function: protein C-terminus binding; identical protein binding; protein homodimerization activity; protein self-association; p53 binding; beta-catenin binding; protein kinase binding; GTPase activator activity; signal transducer activity; protein binding; receptor signaling complex scaffold activity; enzyme binding; ubiquitin protein ligase binding; protein complex scaffold; SMAD binding; receptor binding

Biological Process: cell death; protein polyubiquitination; negative regulation of Wnt receptor signaling pathway; apoptosis; embryonic eye morphogenesis; positive regulation of transcription, DNA-dependent; positive regulation of JNK cascade; negative regulation of protein metabolic process; dorsal/ventral axis specification; nucleocytoplasmic transport; Wnt receptor signaling pathway through beta-catenin; olfactory placode formation; activation of JNK activity; cytoplasmic microtubule organization and biogenesis; sensory perception of sound; positive regulation of ubiquitin-protein ligase activity; Wnt receptor signaling pathway involved in forebrain neuron fate commitment; protein catabolic process; protein homooligomerization; axial mesoderm formation; in utero embryonic development; positive regulation of transforming growth factor beta receptor signaling pathway; muscle cell development; negative regulation of fat cell differentiation; optic placode formation; positive regulation of peptidyl-serine phosphorylation; cellular protein complex assembly; positive regulation of protein ubiquitination; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; forebrain anterior/posterior pattern formation; activation of protein kinase activity; positive regulation of protein catabolic process; positive regulation of protein amino acid phosphorylation; determination of left/right symmetry; positive regulation of GTPase activity

Disease: Caudal Duplication Anomaly; Hepatocellular Carcinoma

Similar Products

Product Notes

The AXIN1 axin1 (Catalog #AAA6189018) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AXIN1 (Axin 1, Axin-1, AXIN, Axis Inhibition Protein 1, hAxin, MGC52315) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AXIN1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AXIN1 axin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AXIN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.