Testing Data
(Detection limit for recombinant GST tagged GOLM1 is 0.1 ng/ml as a capture antibody.)
Mouse GOLM1 Monoclonal Antibody | anti-GOLM1 antibody
GOLM1 (Golgi Membrane Protein 1, C9orf155, FLJ22634, FLJ23608, GOLPH2, GP73, PSEC0257, bA379P1.3) (PE)
Gene Names
GOLM1; GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
GOLM1; Monoclonal Antibody; GOLM1 (Golgi Membrane Protein 1; C9orf155; FLJ22634; FLJ23608; GOLPH2; GP73; PSEC0257; bA379P1.3) (PE); Golgi Membrane Protein 1; bA379P1.3; anti-GOLM1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B10
Specificity
Recognizes GOLM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GOLM1 antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GOLM1 (NP_057632, 302aa-401aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged GOLM1 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GOLM1 is 0.1 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLPH2 monoclonal antibody (M04), clone 3B10.Lane 1: GOLM1 transfected lysate (45.3 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLPH2 monoclonal antibody (M04), clone 3B10.Lane 1: GOLM1 transfected lysate (45.3 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of GOLM1 transfected lysate using anti-GOLM1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GOLM1 MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of GOLM1 transfected lysate using anti-GOLM1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GOLM1 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-GOLM1 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq]
Product Categories/Family for anti-GOLM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,333 Da
NCBI Official Full Name
Golgi membrane protein 1
NCBI Official Synonym Full Names
golgi membrane protein 1
NCBI Official Symbol
GOLM1
NCBI Official Synonym Symbols
GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
NCBI Protein Information
Golgi membrane protein 1; epididymis luminal protein 46; golgi membrane protein GP73; golgi phosphoprotein 2; golgi protein, 73-kD
UniProt Protein Name
Epididymis luminal protein 46
Protein Family
UniProt Gene Name
GOLPH2
UniProt Entry Name
B3KNK9_HUMAN
Similar Products
Product Notes
The GOLM1 golph2 (Catalog #AAA6185920) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GOLM1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GOLM1 golph2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOLM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
