Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 polyclonal antibody. Lane 1: GOLM1 transfected lysate (45.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GOLM1 Polyclonal Antibody | anti-GOLM1 antibody

GOLM1 (Golgi Membrane Protein 1, Golgi Membrane Protein GP73, Golgi Phosphoprotein 2, C9orf155, GOLPH2, PSEC0242, UNQ686/PRO1326, FLJ22634, FLJ23608) (FITC)

Gene Names
GOLM1; GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GOLM1; Polyclonal Antibody; GOLM1 (Golgi Membrane Protein 1; Golgi Membrane Protein GP73; Golgi Phosphoprotein 2; C9orf155; GOLPH2; PSEC0242; UNQ686/PRO1326; FLJ22634; FLJ23608) (FITC); anti-GOLM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GOLM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-GOLM1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GOLM1, aa1-401 (NP_057632.2).
Immunogen Sequence
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 polyclonal antibody. Lane 1: GOLM1 transfected lysate (45.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 polyclonal antibody. Lane 1: GOLM1 transfected lysate (45.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GOLM1 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
Product Categories/Family for anti-GOLM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,273 Da
NCBI Official Full Name
Golgi membrane protein 1
NCBI Official Synonym Full Names
golgi membrane protein 1
NCBI Official Symbol
GOLM1
NCBI Official Synonym Symbols
GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
NCBI Protein Information
Golgi membrane protein 1; epididymis luminal protein 46; golgi membrane protein GP73; golgi phosphoprotein 2; golgi protein, 73-kD
UniProt Protein Name
Golgi membrane protein 1
Protein Family
UniProt Gene Name
GOLM1
UniProt Synonym Gene Names
C9orf155; GOLPH2
UniProt Entry Name
GOLM1_HUMAN

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

GOLM1: Unknown. Cellular response protein to viral infection. Belongs to the GOLM1/CASC4 family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q21.33

Cellular Component: Golgi apparatus; extracellular space; integral to plasma membrane

Molecular Function: protein binding

Biological Process: regulation of lipid metabolic process; nuclear organization and biogenesis

Research Articles on GOLM1

Similar Products

Product Notes

The GOLM1 golm1 (Catalog #AAA6380146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLM1 (Golgi Membrane Protein 1, Golgi Membrane Protein GP73, Golgi Phosphoprotein 2, C9orf155, GOLPH2, PSEC0242, UNQ686/PRO1326, FLJ22634, FLJ23608) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOLM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GOLM1 golm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOLM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.