Mouse HSF4 Monoclonal Antibody | anti-HSF4 antibody

HSF4 (Heat Shock Transcription Factor 4, CTM) (PE)

Cat. Num. AAA6185530

• Gene Names: HSF4; CTM; CTRCT5
• Applications: Western Blot
• Purity: Purified
• Synonyms: HSF4; Monoclonal Antibody; HSF4 (Heat Shock Transcription Factor 4; CTM) (PE); Heat Shock Transcription Factor 4; CTM; anti-HSF4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A4
• Specificity: Recognizes HSF4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-HSF4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HSF4 (NP_001529, 121aa-220aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HSF4 is 0.3 ng/ml as a capture antibody.)

Related Product Information for anti-HSF4 antibody

Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. [provided by RefSeq]

Product Categories/Family for anti-HSF4 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 100913211
• NCBI GeneID: 3299
• NCBI Accession #: NP_001529
• NCBI GenBank Nucleotide #: NM_001538
• UniProt Accession #: Q9ULV5
• Molecular Weight: 50kDa
• NCBI Official Full Name: heat shock factor protein 4 isoform a
• NCBI Official Synonym Full Names: heat shock transcription factor 4
• NCBI Official Symbol: HSF4
• NCBI Official Synonym Symbols: CTM; CTRCT5
• NCBI Protein Information: heat shock factor protein 4
• UniProt Protein Name: Heat shock factor protein 4
• Protein Family: Heat shock factor protein
• UniProt Gene Name: HSF4
• UniProt Synonym Gene Names: HSF 4; hHSF4; HSTF 4
• UniProt Entry Name: HSF4_HUMAN

NCBI Description

Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

HSF4: DNA-binding protein that specifically binds heat shock promoter elements (HSE). Isoform HSF4A represses transcription while the isoform HSF4B activates transcription. Defects in HSF4 are the cause of cataract, zonular (CZ). A form of zonular cataract. Zonular or lamellar cataracts are opacities, broad or narrow, usually consisting of powdery white dots affecting only certain layers or zones between the cortex and nucleus of an otherwise clear lens. The opacity may be so dense as to render the entire central region of the lens completely opaque, or so translucent that vision is hardly if at all impeded. Zonular cataracts generally do not involve the embryonic nucleus, though sometimes they involve the fetal nucleus. Usually sharply separated from a clear cortex outside them, they may have projections from their outer edges known as riders or spokes. Defects in HSF4 are the cause of cataract Marner type (CAM). A form of cataract with variable and progressive opacities. Affected individuals present with zonular cataract, although some have nuclear, anterior polar, or stellate cataract. Finger malformation is observed in some kindreds. Belongs to the HSF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; DNA-binding; Cell development/differentiation

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: nucleoplasm

Molecular Function: sequence-specific DNA binding; transcription factor activity; transcription corepressor activity; protein phosphatase binding

Biological Process: histone H3-K9 demethylation; camera-type eye development; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell differentiation; cell development

Disease: Cataract 5, Multiple Types