Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged OSR1 is approximately 0.3ng/ml as a capture antibody.)

Mouse OSR1 Monoclonal Antibody | anti-OSR1 antibody

OSR1 (Odd-skipped Related 1 (Drosophila), ODD) (PE)

Gene Names
OSR1; ODD
Applications
Western Blot
Purity
Purified
Synonyms
OSR1; Monoclonal Antibody; OSR1 (Odd-skipped Related 1 (Drosophila); ODD) (PE); Odd-skipped Related 1 (Drosophila); ODD; anti-OSR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C6
Specificity
Recognizes OSR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-OSR1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
OSR1 (NP_660303, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged OSR1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OSR1 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-OSR1 antibody
Mouse monoclonal antibody raised against a partial recombinant OSR1.
Product Categories/Family for anti-OSR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,611 Da
NCBI Official Full Name
protein odd-skipped-related 1
NCBI Official Synonym Full Names
odd-skipped related transciption factor 1
NCBI Official Symbol
OSR1
NCBI Official Synonym Symbols
ODD
NCBI Protein Information
protein odd-skipped-related 1; odd-skipped homolog; odd-skipped related 1
UniProt Protein Name
Protein odd-skipped-related 1
Protein Family
UniProt Gene Name
OSR1
UniProt Synonym Gene Names
ODD
UniProt Entry Name
OSR1_HUMAN

Uniprot Description

ODD: Transcription factor that plays a role in the regulation of embryonic heart and urogenital development. Belongs to the Odd C2H2-type zinc-finger protein family.

Protein type: Apoptosis; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: nucleus

Molecular Function: nucleic acid binding; metal ion binding

Biological Process: embryonic forelimb morphogenesis; gonad development; transcription, DNA-dependent; heart development; intermediate mesoderm development; negative regulation of epithelial cell differentiation; palate development; middle ear morphogenesis; negative regulation of transcription from RNA polymerase II promoter; stem cell differentiation; positive regulation of bone mineralization; embryonic hindlimb morphogenesis; pronephros development; odontogenesis; ureteric bud development; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; mesonephros development; embryonic digit morphogenesis; cell differentiation; positive regulation of epithelial cell proliferation; urogenital system development; negative regulation of apoptosis

Similar Products

Product Notes

The OSR1 osr1 (Catalog #AAA6185237) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's OSR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSR1 osr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.