Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and TAOK2 HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-TAOK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse TAOK2 Monoclonal Antibody | anti-TAOK2 antibody

TAOK2 (TAO Kinase 2, KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2) (PE)

Gene Names
TAOK2; PSK; PSK1; TAO1; TAO2; MAP3K17; PSK1-BETA
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TAOK2; Monoclonal Antibody; TAOK2 (TAO Kinase 2; KIAA0881; MAP3K17; PSK; PSK1; TAO1; TAO2) (PE); TAO Kinase 2; TAO2; anti-TAOK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F4
Specificity
Recognizes TAOK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1426
Applicable Applications for anti-TAOK2 antibody
ELISA (EIA), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TAOK2 (AAH51798, 831aa-930aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and TAOK2 HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-TAOK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and TAOK2 HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-TAOK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-TAOK2 antibody
Mouse monoclonal antibody raised against a partial recombinant TAOK2.
Product Categories/Family for anti-TAOK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
TAOK2 protein, partial
NCBI Official Synonym Full Names
TAO kinase 2
NCBI Official Symbol
TAOK2
NCBI Official Synonym Symbols
PSK; PSK1; TAO1; TAO2; MAP3K17; PSK1-BETA
NCBI Protein Information
serine/threonine-protein kinase TAO2

NCBI Description

This gene encodes a serine/threonine protein kinase that is involved in many different processes, including, cell signaling, microtubule organization and stability, and apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Research Articles on TAOK2

Similar Products

Product Notes

The TAOK2 (Catalog #AAA6185010) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TAOK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), In situ Proximity Ligation Assay (Cell). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAOK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAOK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.