Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis of protein-protein interactions between CRK and PDGFRA HeLa cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-PDGFRA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse PDGFRA Monoclonal Antibody | anti-PDGFRA antibody

PDGFRA (Platelet-Derived Growth Factor Receptor, alpha Polypeptide, CD140A, MGC74795, PDGFR2, Rhe-PDGFRA) (HRP)

Gene Names
PDGFRA; CD140A; PDGFR2; PDGFR-2
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PDGFRA; Monoclonal Antibody; PDGFRA (Platelet-Derived Growth Factor Receptor; alpha Polypeptide; CD140A; MGC74795; PDGFR2; Rhe-PDGFRA) (HRP); Platelet-Derived Growth Factor Receptor; Rhe-PDGFRA; anti-PDGFRA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H1-1C9
Specificity
Recognizes PDGFRA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
218
Applicable Applications for anti-PDGFRA antibody
ELISA (EIA), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PDGFRA (AAH15186, 25aa-218aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between CRK and PDGFRA HeLa cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-PDGFRA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between CRK and PDGFRA HeLa cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-PDGFRA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Product Categories/Family for anti-PDGFRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
PDGFRA protein
NCBI Official Synonym Full Names
platelet derived growth factor receptor alpha
NCBI Official Symbol
PDGFRA
NCBI Official Synonym Symbols
CD140A; PDGFR2; PDGFR-2
NCBI Protein Information
platelet-derived growth factor receptor alpha

NCBI Description

This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies suggest that this gene plays a role in organ development, wound healing, and tumor progression. Mutations in this gene have been associated with idiopathic hypereosinophilic syndrome, somatic and familial gastrointestinal stromal tumors, and a variety of other cancers. [provided by RefSeq, Mar 2012]

Research Articles on PDGFRA

Similar Products

Product Notes

The PDGFRA (Catalog #AAA6181692) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PDGFRA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), In situ Proximity Ligation Assay (Cell). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDGFRA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDGFRA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.