Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HNRPM monoclonal antibody (M01), clone 2B6. Western Blot analysis of HNRPM expression in HepG2 (Cat # L019V1).)

Mouse HNRPM Monoclonal Antibody | anti-HNRPM antibody

HNRPM (Heterogeneous Nuclear Ribonucleoprotein M, DKFZp547H118, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1) (HRP)

Gene Names
HNRNPM; CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
HNRPM; Monoclonal Antibody; HNRPM (Heterogeneous Nuclear Ribonucleoprotein M; DKFZp547H118; HNRNPM4; HNRPM4; HTGR1; NAGR1) (HRP); Heterogeneous Nuclear Ribonucleoprotein M; NAGR1; anti-HNRPM antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B6
Specificity
Recognizes HNRPM.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HNRPM antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HNRPM (NP_005959, 17aa-112aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HNRPM monoclonal antibody (M01), clone 2B6. Western Blot analysis of HNRPM expression in HepG2 (Cat # L019V1).)

Western Blot (WB) (HNRPM monoclonal antibody (M01), clone 2B6. Western Blot analysis of HNRPM expression in HepG2 (Cat # L019V1).)

Testing Data

(Detection limit for recombinant GST tagged HNRPM is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HNRPM is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HNRNPM on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HNRNPM on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HNRNPM on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HNRNPM on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-HNRPM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein M isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein M
NCBI Official Symbol
HNRNPM
NCBI Official Synonym Symbols
CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein M; CEA receptor; N-acetylglucosamine receptor 1; heterogenous nuclear ribonucleoprotein M4; hnRNA-binding protein M4
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein M
UniProt Gene Name
HNRNPM
UniProt Synonym Gene Names
HNRPM; NAGR1; hnRNP M
UniProt Entry Name
HNRPM_HUMAN

Uniprot Description

hnRNP M: Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Receptor, misc.; RNA splicing; Spliceosome; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; extracellular matrix; spliceosome; nuclear matrix; membrane; integral to plasma membrane; nucleolus; paraspeckles

Molecular Function: protein domain specific binding; protein binding; RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression

Similar Products

Product Notes

The HNRPM hnrnpm (Catalog #AAA6181438) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPM can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HNRPM hnrnpm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.