Mouse RHOC Monoclonal Antibody | anti-RHOC antibody

RHOC (Ras Homolog Gene Family, Member C, ARH9, ARHC, H9, MGC1448, MGC61427, RHOH9) (HRP)

Cat. Num. AAA6181431

• Gene Names: RHOC; H9; ARH9; ARHC; RHOH9
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: RHOC; Monoclonal Antibody; RHOC (Ras Homolog Gene Family; Member C; ARH9; ARHC; H9; MGC1448; MGC61427; RHOH9) (HRP); Ras Homolog Gene Family; RHOH9; anti-RHOC antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B7
• Specificity: Recognizes RHOC.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 193

• Applicable Applications for anti-RHOC antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RHOC (AAH07245, 1aa-193aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged RHOC is 3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RHOC on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RHOC on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-RHOC antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

References

1. Rhos and Rho kinases in the rat prostate: their possible functional roles and distributions. Saito M, Ohmasa F, Shomori K, Dimitriadis F, Ohiwa H, Shimizu S, Tsounapi P, Kinoshita Y, Satoh K.Mol Cell Biochem. 2011 Jul 1.

NCBI and Uniprot Product Information

• NCBI GI #: 13938243
• NCBI GeneID: 389
• NCBI Official Full Name: Ras homolog gene family, member C
• NCBI Official Synonym Full Names: ras homolog family member C
• NCBI Official Symbol: RHOC
• NCBI Official Synonym Symbols: H9; ARH9; ARHC; RHOH9
• NCBI Protein Information: rho-related GTP-binding protein RhoC
• Protein Family: Rho-related GTP-binding protein

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]