Mouse ID1 Monoclonal Antibody | anti-ID1 antibody

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (HRP)

Cat. Num. AAA6181051

• Gene Names: ID1; ID; bHLHb24
• Applications: Western Blot
• Purity: Purified
• Synonyms: ID1; Monoclonal Antibody; ID1 (Inhibitor of DNA Binding 1; Dominant Negative Helix-loop-Helix Protein; ID; bHLHb24) (HRP); Inhibitor of DNA Binding 1; bHLHb24; anti-ID1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F8
• Specificity: Recognizes ID1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ID1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ID1 (NP_002156, 47aa-155aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.)

Product Categories/Family for anti-ID1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 31317299
• NCBI GeneID: 3397
• NCBI Accession #: NP_002156
• NCBI GenBank Nucleotide #: NM_002165.3
• UniProt Accession #: P41134; O00651; O00652; Q16371; Q16377; Q5TE66; Q5TE67; Q969Z7; Q9H0Z5; Q9H109; A8K537; E1P5L4
• Molecular Weight: 18.5 kDa (178aa) confirmed by MALDI-TOF
• NCBI Official Full Name: DNA-binding protein inhibitor ID-1 isoform a
• NCBI Official Synonym Full Names: inhibitor of DNA binding 1, HLH protein
• NCBI Official Symbol: ID1
• NCBI Official Synonym Symbols: ID; bHLHb24
• NCBI Protein Information: DNA-binding protein inhibitor ID-1
• UniProt Protein Name: DNA-binding protein inhibitor ID-1
• Protein Family: DNA-binding protein inhibitor
• UniProt Gene Name: ID1
• UniProt Synonym Gene Names: BHLHB24; ID; bHLHb24
• UniProt Entry Name: ID1_HUMAN

NCBI Description

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ID1: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 20q11

Cellular Component: nucleoplasm; Golgi apparatus; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription factor activity

Biological Process: circadian rhythm; collagen metabolic process; blood vessel endothelial cell migration; transcription, DNA-dependent; protein destabilization; heart development; negative regulation of transcription factor activity; negative regulation of transcription from RNA polymerase II promoter; regulation of angiogenesis; negative regulation of DNA binding; BMP signaling pathway; response to antibiotic; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; blood vessel morphogenesis; negative regulation of osteoblast differentiation; endothelial cell morphogenesis; angiogenesis; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis