Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5.Lane 1: DMAP1 transfected lysate (53 KDa).Lane 2: Non-transfected lysate.)

Mouse DMAP1 Monoclonal Antibody | anti-DMAP1 antibody

DMAP1 (DNA Methyltransferase 1 Associated Protein 1, DKFZp686L09142, DNMAP1, DNMTAP1, EAF2, FLJ11543, KIAA1425, SWC4) (HRP)

Gene Names
DMAP1; EAF2; SWC4; MEAF2; DNMAP1; DNMTAP1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DMAP1; Monoclonal Antibody; DMAP1 (DNA Methyltransferase 1 Associated Protein 1; DKFZp686L09142; DNMAP1; DNMTAP1; EAF2; FLJ11543; KIAA1425; SWC4) (HRP); DNA Methyltransferase 1 Associated Protein 1; SWC4; anti-DMAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A5
Specificity
Recognizes DMAP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DMAP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DMAP1 (NP_061973, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5.Lane 1: DMAP1 transfected lysate (53 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5.Lane 1: DMAP1 transfected lysate (53 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-DMAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
DNA methyltransferase 1-associated protein 1
NCBI Official Synonym Full Names
DNA methyltransferase 1 associated protein 1
NCBI Official Symbol
DMAP1
NCBI Official Synonym Symbols
EAF2; SWC4; MEAF2; DNMAP1; DNMTAP1
NCBI Protein Information
DNA methyltransferase 1-associated protein 1
UniProt Protein Name
DNA methyltransferase 1-associated protein 1
UniProt Gene Name
DMAP1
UniProt Synonym Gene Names
KIAA1425
UniProt Entry Name
DMAP1_HUMAN

NCBI Description

This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

DMAP1: Involved in transcription repression and activation. Its interaction with HDAC2 may provide a mechanism for histone deacetylation in heterochromatin following replication of DNA at late firing origins. Can also repress transcription independently of histone deacetylase activity. May specifically potentiate DAXX- mediated repression of glucocorticoid receptor-dependent transcription. Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Participates in the nuclear localization of URI1 and increases its transcriptional corepressor activity.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; cytoplasm; replication fork; nucleus

Molecular Function: protein binding; chromatin binding; transcription corepressor activity

Biological Process: chromatin remodeling; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of growth; DNA methylation; positive regulation of transcription factor import into nucleus; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; DNA repair

Research Articles on DMAP1

Similar Products

Product Notes

The DMAP1 dmap1 (Catalog #AAA6180602) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DMAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DMAP1 dmap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DMAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.