Mouse DMAP1 Monoclonal Antibody | anti-DMAP1 antibody

DMAP1 (DNA Methyltransferase 1 Associated Protein 1, DKFZp686L09142, DNMAP1, DNMTAP1, EAF2, FLJ11543, KIAA1425, SWC4) (HRP)

Cat. Num. AAA6180602

• Gene Names: DMAP1; EAF2; SWC4; MEAF2; DNMAP1; DNMTAP1
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: DMAP1; Monoclonal Antibody; DMAP1 (DNA Methyltransferase 1 Associated Protein 1; DKFZp686L09142; DNMAP1; DNMTAP1; EAF2; FLJ11543; KIAA1425; SWC4) (HRP); DNA Methyltransferase 1 Associated Protein 1; SWC4; anti-DMAP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A5
• Specificity: Recognizes DMAP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-DMAP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DMAP1 (NP_061973, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5.Lane 1: DMAP1 transfected lysate (53 KDa).Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-DMAP1 antibody

Antibodies; Enzymes; Methyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 13123776
• NCBI GeneID: 55929
• NCBI Accession #: NP_061973
• NCBI GenBank Nucleotide #: NM_019100
• UniProt Accession #: Q9NPF5
• Molecular Weight: 53kDa
• NCBI Official Full Name: DNA methyltransferase 1-associated protein 1
• NCBI Official Synonym Full Names: DNA methyltransferase 1 associated protein 1
• NCBI Official Symbol: DMAP1
• NCBI Official Synonym Symbols: EAF2; SWC4; MEAF2; DNMAP1; DNMTAP1
• NCBI Protein Information: DNA methyltransferase 1-associated protein 1
• UniProt Protein Name: DNA methyltransferase 1-associated protein 1
• Protein Family: DNA methyltransferase 1-associated protein
• UniProt Gene Name: DMAP1
• UniProt Synonym Gene Names: KIAA1425
• UniProt Entry Name: DMAP1_HUMAN

NCBI Description

This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

DMAP1: Involved in transcription repression and activation. Its interaction with HDAC2 may provide a mechanism for histone deacetylation in heterochromatin following replication of DNA at late firing origins. Can also repress transcription independently of histone deacetylase activity. May specifically potentiate DAXX- mediated repression of glucocorticoid receptor-dependent transcription. Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Participates in the nuclear localization of URI1 and increases its transcriptional corepressor activity.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; cytoplasm; replication fork; nucleus

Molecular Function: protein binding; chromatin binding; transcription corepressor activity

Biological Process: chromatin remodeling; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of growth; DNA methylation; positive regulation of transcription factor import into nucleus; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; DNA repair