Mouse RPS6KA6 Monoclonal Antibody | anti-RPS6KA6 antibody

RPS6KA6 (Ribosomal Protein S6 Kinase, 90kD, Polypeptide 6, RSK4) (HRP)

Cat. Num. AAA6180472

• Gene Names: RPS6KA6; RSK4; PP90RSK4
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: RPS6KA6; Monoclonal Antibody; RPS6KA6 (Ribosomal Protein S6 Kinase; 90kD; Polypeptide 6; RSK4) (HRP); Ribosomal Protein S6 Kinase; RSK4; anti-RPS6KA6 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8D2
• Specificity: Recognizes RPS6KA6.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RPS6KA6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RPS6KA6 (NP_055311.1, 636aa-745aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS6KA6 monoclonal antibody (M07), clone 8D2 Western Blot analysis of RPS6KA6 expression in PC-12 (Cat # L012V1).)

Product Categories/Family for anti-RPS6KA6 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7657526
• NCBI GeneID: 27330
• NCBI Accession #: NP_055311.1
• NCBI GenBank Nucleotide #: NM_014496.4
• UniProt Accession #: Q9UK32; Q6FHX2; Q8WX28; Q9H4S6; B2R854
• Molecular Weight: 83,872 Da
• NCBI Official Full Name: ribosomal protein S6 kinase alpha-6
• NCBI Official Synonym Full Names: ribosomal protein S6 kinase, 90kDa, polypeptide 6
• NCBI Official Symbol: RPS6KA6
• NCBI Official Synonym Symbols: RSK4; PP90RSK4
• NCBI Protein Information: ribosomal protein S6 kinase alpha-6; RSK-4; p90RSK6; p90-RSK 6; S6K-alpha 6; S6K-alpha-6; ribosomal S6 kinase 4; 90 kDa ribosomal protein S6 kinase 6
• UniProt Protein Name: Ribosomal protein S6 kinase alpha-6
• Protein Family: Ribosomal protein S6 kinase
• UniProt Gene Name: RPS6KA6
• UniProt Synonym Gene Names: RSK4; S6K-alpha-6; p90-RSK 6; p90RSK6; RSK-4
• UniProt Entry Name: KS6A6_HUMAN

NCBI Description

This gene encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways. [provided by RefSeq, Jan 2010]

Uniprot Description

RSK4: an AGC kinase of the RSK family. Phosphorylates a wide range of substrates including ribosomal protein S6. Implicated in the activation of the mitogen- activated kinase cascade. May play a role in normal neuronal development.

Protein type: Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; AGC group; RSK family; RSK subfamily

Chromosomal Location of Human Ortholog: Xq21

Cellular Component: nucleoplasm; mitochondrion; nucleolus; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: axon guidance; synaptic transmission; negative regulation of embryonic development; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; central nervous system development; signal transduction; protein amino acid phosphorylation