Mouse IRX3 Monoclonal Antibody | anti-IRX3 antibody

IRX3 (Iroquois Homeobox 3, IRX-1) (HRP)

Cat. Num. AAA6179994

• Gene Names: IRX3; IRX-1; IRXB1
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: IRX3; Monoclonal Antibody; IRX3 (Iroquois Homeobox 3; IRX-1) (HRP); Iroquois Homeobox 3; IRX-1; anti-IRX3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D7
• Specificity: Recognizes IRX3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-IRX3 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IRX3 (NP_077312, 182aa-285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IRX3 monoclonal antibody (M05), clone 1D7 Western Blot analysis of IRX3 expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IRX3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IRX3 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IRX3 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(IRX3 monoclonal antibody (M05), clone 1D7. Western Blot analysis of IRX3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(IRX3 monoclonal antibody (M05), clone 1D7. Western Blot analysis of IRX3 expression in PC-12 (Cat # L012V1).)

Product Categories/Family for anti-IRX3 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 226371735
• NCBI GeneID: 79191
• NCBI Accession #: NP_077312
• NCBI GenBank Nucleotide #: NM_024336
• UniProt Accession #: P78415
• Molecular Weight: 52kDa
• NCBI Official Full Name: iroquois-class homeodomain protein IRX-3
• NCBI Official Synonym Full Names: iroquois homeobox 3
• NCBI Official Symbol: IRX3
• NCBI Official Synonym Symbols: IRX-1; IRXB1
• NCBI Protein Information: iroquois-class homeodomain protein IRX-3
• UniProt Protein Name: Iroquois-class homeodomain protein IRX-3
• Protein Family: Iroquois-class homeodomain protein
• UniProt Gene Name: IRX3
• UniProt Synonym Gene Names: IRXB1
• UniProt Entry Name: IRX3_HUMAN

NCBI Description

IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation of vertebrate embryos (Lewis et al., 1999 [PubMed 10370142]).[supplied by OMIM, Aug 2009]

Uniprot Description

IRX3: Transcription factor. Involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenitor factors, which are repressed by SHH signals. Involved in the transcriptional repression of MNX1 in non-motor neuron cells. Belongs to the TALE/IRO homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: axon; cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: negative regulation of neuron differentiation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; mesoderm development; positive regulation of neuron differentiation; metanephros development