Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ETV5 monoclonal antibody (M02), clone 7C10 Western Blot analysis of ETV5 expression in Hela S3 NE (Cat # L013V3).)

Mouse ETV5 Monoclonal Antibody | anti-ETV5 antibody

ETV5 (Ets Variant 5, ERM) (HRP)

Gene Names
ETV5; ERM
Applications
Western Blot
Purity
Purified
Synonyms
ETV5; Monoclonal Antibody; ETV5 (Ets Variant 5; ERM) (HRP); Ets Variant 5; ERM; anti-ETV5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7C10
Specificity
Recognizes ETV5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ETV5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ETV5 (NP_004445, 181aa-290aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ETV5 monoclonal antibody (M02), clone 7C10 Western Blot analysis of ETV5 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (ETV5 monoclonal antibody (M02), clone 7C10 Western Blot analysis of ETV5 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged ETV5 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ETV5 is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in Raw 264.7 (Cat # L024V1).)

Western Blot (WB) (ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in Raw 264.7 (Cat # L024V1).)
Product Categories/Family for anti-ETV5 antibody
References
1. Cyclin D1 enhances the response to estrogen and progesterone by regulating progesterone receptor expression.Yang C, Chen L, Li C, Lynch MC, Brisken C, Schmidt EV.Mol Cell Biol. 2010 Apr 19. 2.Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer. Helgeson BE, Tomlins SA, Shah N, Laxman B, Cao Q, Prensner JR, Cao X, Singla N, Montie JE, Varambally S, Mehra R, Chinnaiyan AM.Cancer Res. 2008 Jan 1;68(1):73-80.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,422 Da
NCBI Official Full Name
ETS translocation variant 5
NCBI Official Synonym Full Names
ets variant 5
NCBI Official Symbol
ETV5
NCBI Official Synonym Symbols
ERM
NCBI Protein Information
ETS translocation variant 5; ets-related molecule; ets-related protein ERM
UniProt Protein Name
ETS translocation variant 5
Protein Family
UniProt Gene Name
ETV5
UniProt Synonym Gene Names
ERM
UniProt Entry Name
ETV5_HUMAN

Uniprot Description

ERM: Binds to DNA sequences containing the consensus nucleotide core sequence GGAA. Belongs to the ETS family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; regulation of synapse organization and biogenesis; neuromuscular synaptic transmission; locomotory behavior; positive regulation of transcription from RNA polymerase II promoter; positive regulation of neuron differentiation; cell differentiation; male germ-line stem cell division

Similar Products

Product Notes

The ETV5 etv5 (Catalog #AAA6179222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ETV5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ETV5 etv5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ETV5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.