Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (COL19A1 monoclonal antibody (M01), clone 1B2. Western Blot analysis of COL19A1 expression in K-562.)

Mouse COL19A1 Monoclonal Antibody | anti-COL19A1 antibody

COL19A1 (Collagen, Type XIX, alpha 1, COL9A1L, D6S228E) (FITC)

Gene Names
COL19A1; COL9A1L; D6S228E
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
COL19A1; Monoclonal Antibody; COL19A1 (Collagen; Type XIX; alpha 1; COL9A1L; D6S228E) (FITC); Collagen; D6S228E; anti-COL19A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes COL19A1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1142
Applicable Applications for anti-COL19A1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
COL19A1 (NP_001849, 27aa-114aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(COL19A1 monoclonal antibody (M01), clone 1B2. Western Blot analysis of COL19A1 expression in K-562.)

Western Blot (WB) (COL19A1 monoclonal antibody (M01), clone 1B2. Western Blot analysis of COL19A1 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged COL19A1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged COL19A1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-COL19A1 antibody
This gene encodes the alpha chain of type XIX collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Although the function of this collagen is not known, other members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. The transcript produced from this gene has an unusually large 3' UTR which has not been completely sequenced. [provided by RefSeq]
Product Categories/Family for anti-COL19A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
collagen alpha-1(XIX) chain
NCBI Official Synonym Full Names
collagen type XIX alpha 1 chain
NCBI Official Symbol
COL19A1
NCBI Official Synonym Symbols
COL9A1L; D6S228E
NCBI Protein Information
collagen alpha-1(XIX) chain
UniProt Protein Name
Collagen alpha-1(XIX) chain
UniProt Gene Name
COL19A1
UniProt Entry Name
COJA1_HUMAN

NCBI Description

This gene encodes the alpha chain of type XIX collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Although the function of this collagen is not known, other members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. The transcript produced from this gene has an unusually large 3' UTR which has not been completely sequenced. [provided by RefSeq, Jul 2008]

Uniprot Description

COL19A1: May act as a cross-bridge between fibrils and other extracellular matrix molecules. Involved in skeletal myogenesis in the developing esophagus. May play a role in organization of the pericellular matrix or the sphinteric smooth muscle. Belongs to the fibril-associated collagens with interrupted helices (FACIT) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 6q12-q13

Cellular Component: proteinaceous extracellular matrix; collagen; endoplasmic reticulum lumen; extracellular region

Molecular Function: protein binding, bridging; extracellular matrix structural constituent

Biological Process: collagen catabolic process; extracellular matrix disassembly; cell-cell adhesion; skeletal muscle development; extracellular matrix organization and biogenesis; cell adhesion; cell differentiation; skeletal development

Research Articles on COL19A1

Similar Products

Product Notes

The COL19A1 col19a1 (Catalog #AAA6179119) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COL19A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COL19A1 col19a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COL19A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.