Western Blot (WB)
(Western Blot analysis of C17orf37 expression in transfected 293T cell line by C17orf37 monoclonal antibody (M09), clone 4D4.Lane 1: C17orf37 transfected lysate (Predicted MW: 12.4 KDa).Lane 2: Non-transfected lysate.)
Mouse C17orf37 Monoclonal Antibody | anti-C17orf37 antibody
C17orf37 (Chromosome 17 Open Reading Frame 37, C35, MGC14832, ORB3, RDX12, XTP4) (FITC)
Gene Names
MIEN1; C35; ORB3; XTP4; RDX12; C17orf37
Applications
Western Blot
Purity
Purified
Synonyms
C17orf37; Monoclonal Antibody; C17orf37 (Chromosome 17 Open Reading Frame 37; C35; MGC14832; ORB3; RDX12; XTP4) (FITC); Chromosome 17 Open Reading Frame 37; XTP4; anti-C17orf37 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D4
Specificity
Recognizes C17orf37.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-C17orf37 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
C17orf37 (NP_115715.3, 1aa-115aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of C17orf37 expression in transfected 293T cell line by C17orf37 monoclonal antibody (M09), clone 4D4.Lane 1: C17orf37 transfected lysate (Predicted MW: 12.4 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of C17orf37 expression in transfected 293T cell line by C17orf37 monoclonal antibody (M09), clone 4D4.Lane 1: C17orf37 transfected lysate (Predicted MW: 12.4 KDa).Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged C17orf37 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged C17orf37 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-C17orf37 antibody
Mouse monoclonal antibody raised against a full-length recombinant C17orf37.
Product Categories/Family for anti-C17orf37 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,403 Da
NCBI Official Full Name
migration and invasion enhancer 1
NCBI Official Synonym Full Names
migration and invasion enhancer 1
NCBI Official Symbol
MIEN1
NCBI Official Synonym Symbols
C35; ORB3; XTP4; RDX12; C17orf37
NCBI Protein Information
migration and invasion enhancer 1; HBV X-transactivated gene 4 protein; HBV XAg-transactivated protein 4; protein C17orf37
UniProt Protein Name
Migration and invasion enhancer 1
UniProt Gene Name
MIEN1
UniProt Synonym Gene Names
C17orf37; RDX12; XTP4
UniProt Entry Name
MIEN1_HUMAN
Uniprot Description
MIEN1: Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process. Belongs to the SelWTH family.
Chromosomal Location of Human Ortholog: 17q12
Cellular Component: nucleoplasm; cytoplasm; cytosol
Molecular Function: selenium binding
Biological Process: positive regulation of filopodium formation; cell redox homeostasis; apoptosis; negative regulation of apoptosis; positive regulation of cell migration
Research Articles on C17orf37
Similar Products
Product Notes
The C17orf37 mien1 (Catalog #AAA6178691) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C17orf37 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C17orf37 mien1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C17orf37, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
