Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EXOSC3 is 0.1 ng/ml as a capture antibody.)

Mouse EXOSC3 Monoclonal Antibody | anti-EXOSC3 antibody

EXOSC3 (exosome Component 3, CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp40p, p10) (FITC)

Gene Names
EXOSC3; p10; PCH1B; RRP40; Rrp40p; CGI-102; hRrp-40; bA3J10.7
Applications
Immunoprecipitation
Purity
Purified
Synonyms
EXOSC3; Monoclonal Antibody; EXOSC3 (exosome Component 3; CGI-102; MGC15120; MGC723; RP11-3J10.8; RRP40; Rrp40p; bA3J10.7; hRrp40p; p10) (FITC); exosome Component 3; p10; anti-EXOSC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
300000
Specificity
Recognizes EXOSC3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-EXOSC3 antibody
Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EXOSC3 (NP_057126.2, 176aa-274aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EXOSC3 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EXOSC3 is 0.1 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of EXOSC3 transfected lysate using anti-EXOSC3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EXOSC3 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of EXOSC3 transfected lysate using anti-EXOSC3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EXOSC3 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-EXOSC3 antibody
Mouse monoclonal antibody raised against a partial recombinant EXOSC3.
Product Categories/Family for anti-EXOSC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,248 Da
NCBI Official Full Name
exosome complex component RRP40 isoform 1
NCBI Official Synonym Full Names
exosome component 3
NCBI Official Symbol
EXOSC3
NCBI Official Synonym Symbols
p10; PCH1B; RRP40; Rrp40p; CGI-102; hRrp-40; bA3J10.7
NCBI Protein Information
exosome complex component RRP40
Protein Family

NCBI Description

This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]

Research Articles on EXOSC3

Similar Products

Product Notes

The EXOSC3 (Catalog #AAA6177796) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EXOSC3 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EXOSC3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXOSC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.