Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse TLX3 Monoclonal Antibody | anti-TLX3 antibody

TLX3 (T-Cell Leukemia Homeobox 3, HOX11L2, MGC29804, RNX) (FITC)

Gene Names
TLX3; RNX; HOX11L2
Applications
Western Blot
Purity
Purified
Synonyms
TLX3; Monoclonal Antibody; TLX3 (T-Cell Leukemia Homeobox 3; HOX11L2; MGC29804; RNX) (FITC); T-Cell Leukemia Homeobox 3; RNX; anti-TLX3 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5D2
Specificity
Recognizes TLX3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TLX3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TLX3 (NP_066305, 192aa-291aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-TLX3 antibody
RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]). [supplied by OMIM]
Product Categories/Family for anti-TLX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 32 kDa

Observed: 30 kDa
NCBI Official Full Name
T-cell leukemia homeobox protein 3
NCBI Official Synonym Full Names
T-cell leukemia homeobox 3
NCBI Official Symbol
TLX3
NCBI Official Synonym Symbols
RNX; HOX11L2
NCBI Protein Information
T-cell leukemia homeobox protein 3; homeo box 11-like 2; homeobox protein Hox-11L2; T-cell leukemia, homeobox 3
UniProt Protein Name
T-cell leukemia homeobox protein 3
UniProt Gene Name
TLX3
UniProt Synonym Gene Names
HOX11L2
UniProt Entry Name
TLX3_HUMAN

NCBI Description

RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]).[supplied by OMIM, Mar 2008]

Uniprot Description

TLX3:

Protein type: Transcription factor; Cell development/differentiation; DNA-binding

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: negative regulation of neuron differentiation; central nervous system development; regulation of transcription, DNA-dependent; neuron migration; neuron fate specification; neurological control of breathing; respiratory gaseous exchange

Research Articles on TLX3

Similar Products

Product Notes

The TLX3 tlx3 (Catalog #AAA6176480) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TLX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TLX3 tlx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual