Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EPHA1 is 1 ng/ml as a capture antibody.)

Mouse EPHA1 Monoclonal Antibody | anti-EPHA1 antibody

EPHA1 (EPH Receptor A1, EPH, EPHT, EPHT1, MGC163163) (Biotin)

Gene Names
EPHA1; EPH; EPHT; EPHT1
Applications
Western Blot
Purity
Purified
Synonyms
EPHA1; Monoclonal Antibody; EPHA1 (EPH Receptor A1; EPH; EPHT; EPHT1; MGC163163) (Biotin); EPH Receptor A1; MGC163163; anti-EPHA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8D4
Specificity
Recognizes EPHA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-EPHA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EPHA1 (NP_005223, 394aa-500aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EPHA1 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPHA1 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-EPHA1 antibody
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis. [provided by RefSeq]
Product Categories/Family for anti-EPHA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,069 Da
NCBI Official Full Name
ephrin type-A receptor 1
NCBI Official Synonym Full Names
EPH receptor A1
NCBI Official Symbol
EPHA1
NCBI Official Synonym Symbols
EPH; EPHT; EPHT1
NCBI Protein Information
ephrin type-A receptor 1; eph tyrosine kinase 1; erythropoietin-producing hepatoma amplified sequence; erythropoietin-producing hepatoma receptor; hEpha1; oncogene EPH; soluble EPHA1 variant 1; soluble EPHA1 variant 2; tyrosine-protein kinase receptor EPH
UniProt Protein Name
Ephrin type-A receptor 1
Protein Family
UniProt Gene Name
EPHA1
UniProt Synonym Gene Names
EPH; EPHT; EPHT1; hEpha1
UniProt Entry Name
EPHA1_HUMAN

Uniprot Description

EphA1: a receptor tyrosine kinase. Receptor for members of the ephrin-A family. Binds with a low affinity to ephrin-A1. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. Misexpressed in several cancers, including upregulation in head and neck cancer, and downregulation in invasive breast cancer cell lines and glioblastoma

Protein type: Membrane protein, integral; EC 2.7.10.1; Protein kinase, TK; Protein kinase, tyrosine (receptor); Kinase, protein; TK group; Eph family

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: transmembrane-ephrin receptor activity; protein kinase binding; ATP binding; protein kinase activity

Biological Process: axon guidance; positive regulation of angiogenesis; peptidyl-tyrosine phosphorylation; cell surface receptor linked signal transduction; somatic stem cell maintenance; protein amino acid autophosphorylation; positive regulation of cell proliferation; positive regulation of stress fiber formation; ephrin receptor signaling pathway; negative regulation of protein kinase activity; angiogenesis; positive regulation of cell-matrix adhesion; negative regulation of cell migration; positive regulation of cell migration

Similar Products

Product Notes

The EPHA1 epha1 (Catalog #AAA6174641) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EPHA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPHA1 epha1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPHA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.