Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PBXIP1 is 0.03 ng/ml as a capture antibody.)

Mouse PBXIP1 Monoclonal Antibody | anti-PBXIP1 antibody

PBXIP1 (pre-B-Cell Leukemia Homeobox Interacting Protein 1, HPIP) (Biotin)

Gene Names
PBXIP1; HPIP
Applications
Western Blot
Purity
Purified
Synonyms
PBXIP1; Monoclonal Antibody; PBXIP1 (pre-B-Cell Leukemia Homeobox Interacting Protein 1; HPIP) (Biotin); pre-B-Cell Leukemia Homeobox Interacting Protein 1; HPIP; anti-PBXIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
70
Specificity
Recognizes PBXIP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PBXIP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PBXIP1 (NP_065385.2, 480aa-578aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKEGKRQGPKEPPRKSGSFHSSGEKQKQPRWREGTKDSHDPLPSWAELL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PBXIP1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PBXIP1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-PBXIP1 antibody
Mouse monoclonal antibody raised against a partial recombinant PBXIP1.
Product Categories/Family for anti-PBXIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,643 Da
NCBI Official Full Name
pre-B-cell leukemia transcription factor-interacting protein 1
NCBI Official Synonym Full Names
pre-B-cell leukemia homeobox interacting protein 1
NCBI Official Symbol
PBXIP1
NCBI Official Synonym Symbols
HPIP
NCBI Protein Information
pre-B-cell leukemia transcription factor-interacting protein 1; OTTHUMP00000035484; OTTHUMP00000035485; OTTHUMP00000035486; OTTHUMP00000035487; hematopoietic PBX-interacting protein; pre-B-cell leukemia transcription factor interacting protein 1
UniProt Protein Name
Pre-B-cell leukemia transcription factor-interacting protein 1
UniProt Gene Name
PBXIP1
UniProt Synonym Gene Names
HPIP

Uniprot Description

PBXIP1: Regulator of pre-B-cell leukemia transcription factors (BPXs) function. Inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. Tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: cytosol; microtubule; nucleus

Molecular Function: protein binding; transcription corepressor activity

Biological Process: cell differentiation; multicellular organism development; negative regulation of transcription, DNA-dependent

Similar Products

Product Notes

The PBXIP1 pbxip1 (Catalog #AAA6174627) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PBXIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBXIP1 pbxip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBXIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.