Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TSC22D1 is 0.1 ng/ml as a capture antibody.)

Mouse TSC22D1 Monoclonal Antibody | anti-TSC22D1 antibody

TSC22D1 (TSC22 Domain Family, Member 1, DKFZp686O19206, MGC17597, RP11-269C23.2, TGFB1I4, TSC22) (Biotin)

Gene Names
TSC22D1; Ptg-2; TSC22; TGFB1I4
Applications
Western Blot
Purity
Purified
Synonyms
TSC22D1; Monoclonal Antibody; TSC22D1 (TSC22 Domain Family; Member 1; DKFZp686O19206; MGC17597; RP11-269C23.2; TGFB1I4; TSC22) (Biotin); TSC22 Domain Family; TSC22; anti-TSC22D1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
200
Specificity
Recognizes TSC22D1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
144
Applicable Applications for anti-TSC22D1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TSC22D1 (AAH16867, 1aa-144aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TSC22D1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TSC22D1 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M06), clone 2E2.Lane 1: TSC22D1 transfected lysate (15.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M06), clone 2E2.Lane 1: TSC22D1 transfected lysate (15.7 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-TSC22D1 antibody
TSC22D1 encodes a transcription factor and belongs to the large family of early response genes. [supplied by OMIM]
Product Categories/Family for anti-TSC22D1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
TSC22 domain family, member 1
NCBI Official Synonym Full Names
TSC22 domain family member 1
NCBI Official Symbol
TSC22D1
NCBI Official Synonym Symbols
Ptg-2; TSC22; TGFB1I4
NCBI Protein Information
TSC22 domain family protein 1

NCBI Description

This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]

Research Articles on TSC22D1

Similar Products

Product Notes

The TSC22D1 (Catalog #AAA6173670) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TSC22D1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSC22D1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSC22D1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.