Mouse RASA1 Monoclonal Antibody | anti-RASA1 antibody

RASA1 (RAS p21 Protein Activator (GTPase Activating Protein) 1, CM-AVM, CMAVM, DKFZp434N071, GAP, PKWS, RASA, RASGAP, p120GAP, p120RASGAP) (Biotin)

Cat. Num. AAA6173643

• Gene Names: RASA1; GAP; PKWS; RASA; p120; CMAVM; CM-AVM; CMAVM1; RASGAP; p120GAP; p120RASGAP
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: RASA1; Monoclonal Antibody; RASA1 (RAS p21 Protein Activator (GTPase Activating Protein) 1; CM-AVM; CMAVM; DKFZp434N071; GAP; PKWS; RASA; RASGAP; p120GAP; p120RASGAP) (Biotin); RAS p21 Protein Activator (GTPase Activating Protein) 1; p120RASGAP; anti-RASA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1000000
• Specificity: Recognizes RASA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1047

• Applicable Applications for anti-RASA1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RASA1 (NP_002881, 948aa-1047aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RASA1 is 1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-RASA1 antibody

The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. [provided by RefSeq]

Product Categories/Family for anti-RASA1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506431
• NCBI GeneID: 5921
• NCBI Accession #: NP_002881
• NCBI GenBank Nucleotide #: NP_002881.1
• UniProt Accession #: P20936
• NCBI Official Full Name: ras GTPase-activating protein 1 isoform 1
• NCBI Official Synonym Full Names: RAS p21 protein activator 1
• NCBI Official Symbol: RASA1
• NCBI Official Synonym Symbols: GAP; PKWS; RASA; p120; CMAVM; CM-AVM; CMAVM1; RASGAP; p120GAP; p120RASGAP
• NCBI Protein Information: ras GTPase-activating protein 1
• UniProt Protein Name: Ras GTPase-activating protein 1
• Protein Family: Ras GTPase-activating protein
• UniProt Gene Name: RASA1
• UniProt Synonym Gene Names: GAP; RASA; GAP; GTPase-activating protein; RasGAP
• UniProt Entry Name: RASA1_HUMAN

NCBI Description

The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Mutations also have been associated with hereditary capillary malformations (CM) with or without arteriovenous malformations (AVM) and Parkes Weber syndrome. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. [provided by RefSeq, May 2012]

Uniprot Description

RASA1: a GTPase activator for normal RAS p21 but not its oncogenic counterpart, converting it to the putatively inactive GDP-bound state. Acting as a suppressor of RAS function, it enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Two alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; GAPs, Ras; Oncoprotein; GAPs

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: ruffle; cytoplasm; cytosol

Molecular Function: GTPase binding; protein binding; glycoprotein binding; potassium channel inhibitor activity; receptor binding

Biological Process: axon guidance; negative regulation of cell adhesion; negative regulation of cell-matrix adhesion; signal transduction; regulation of cell shape; regulation of actin filament polymerization; embryonic development; cytokinesis after mitosis; regulation of RNA metabolic process; ephrin receptor signaling pathway; blood vessel morphogenesis; negative regulation of Ras protein signal transduction; negative regulation of neuron apoptosis; vascular endothelial growth factor receptor signaling pathway; vasculogenesis

Disease: Parkes Weber Syndrome; Capillary Malformation-arteriovenous Malformation; Basal Cell Carcinoma, Susceptibility To, 1