Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NR0B1 expression in transfected 293T cell line by NR0B1 monoclonal antibody (M07), clone 3G8.Lane 1: NR0B1 transfected lysate (51.7 KDa).Lane 2: Non-transfected lysate.)

Mouse NR0B1 Monoclonal Antibody | anti-NR0B1 antibody

NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1) (Biotin)

Gene Names
NR0B1; AHC; AHX; DSS; GTD; HHG; AHCH; DAX1; DAX-1; NROB1; SRXY2
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NR0B1; Monoclonal Antibody; NR0B1 (Nuclear Receptor Subfamily 0; Group B; Member 1; AHC; AHCH; AHX; DAX-1; DAX1; DSS; GTD; HHG; NROB1) (Biotin); Nuclear Receptor Subfamily 0; NROB1; anti-NR0B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G8
Specificity
Recognizes NR0B1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NR0B1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NR0B1 (NP_000466, 361aa-470aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NR0B1 expression in transfected 293T cell line by NR0B1 monoclonal antibody (M07), clone 3G8.Lane 1: NR0B1 transfected lysate (51.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NR0B1 expression in transfected 293T cell line by NR0B1 monoclonal antibody (M07), clone 3G8.Lane 1: NR0B1 transfected lysate (51.7 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-NR0B1 antibody
This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq]
Product Categories/Family for anti-NR0B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
190
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,590 Da
NCBI Official Full Name
nuclear receptor subfamily 0 group B member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 0, group B, member 1
NCBI Official Symbol
NR0B1
NCBI Official Synonym Symbols
AHC; AHX; DSS; GTD; HHG; AHCH; DAX1; DAX-1; NROB1; SRXY2
NCBI Protein Information
nuclear receptor subfamily 0 group B member 1
UniProt Protein Name
Nuclear receptor subfamily 0 group B member 1
UniProt Gene Name
NR0B1
UniProt Synonym Gene Names
AHC; DAX1
UniProt Entry Name
NR0B1_HUMAN

NCBI Description

This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq, Jul 2008]

Uniprot Description

NR0B1: orphan nuclear receptor. Component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. May also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency. Homodimerizes with STF-1, NR5A2, NR0B2 and with COPS2. Shuttles between the cytoplasm and nucleus. Homodimers exits in the cytoplasm and in the nucleus. Homodimerization involved an interaction between amino and carboxy termini involving LXXLL motifs and steroid binding domain (AF-2 motif). Heterodimerizes with STF-1 and NROB2 through its N-terminal LXXLL motifs. Defects in NR0B1 are the cause of congenital X-linked adrenal hypoplasia. Two alternatively spliced human isoforms have been described.

Protein type: Nuclear receptor

Chromosomal Location of Human Ortholog: Xp21.3

Cellular Component: nucleoplasm; polysomal ribosome; membrane; cytoplasm; nucleus

Molecular Function: protein domain specific binding; DNA hairpin binding; protein binding; ligand-dependent nuclear receptor activity; protein homodimerization activity; DNA binding; AF-2 domain binding; RNA binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription corepressor activity; transcription factor binding; steroid hormone receptor binding

Biological Process: transcription initiation from RNA polymerase II promoter; hypothalamus development; negative regulation of steroid hormone receptor signaling pathway; intracellular receptor-mediated signaling pathway; gonad development; adrenal gland development; negative regulation of transcription factor activity; male gonad development; Sertoli cell differentiation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of cell differentiation; protein localization; Leydig cell differentiation; pituitary gland development; male sex determination; steroid hormone mediated signaling; spermatogenesis; gene expression; negative regulation of transcription, DNA-dependent; steroid biosynthetic process

Disease: 46,xy Sex Reversal 2; Adrenal Hypoplasia, Congenital

Research Articles on NR0B1

Similar Products

Product Notes

The NR0B1 nr0b1 (Catalog #AAA6173548) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NR0B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR0B1 nr0b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR0B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.