Mouse BOLL Monoclonal Antibody | anti-BOLL antibody

BOLL (Bol, Boule-like (Drosophila)) (Biotin)

Cat. Num. AAA6172049

• Gene Names: BOLL; BOULE
• Applications: Western Blot
• Purity: Purified
• Synonyms: BOLL; Monoclonal Antibody; BOLL (Bol; Boule-like (Drosophila)) (Biotin); Bol; Boule-like (Drosophila); anti-BOLL antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G8
• Specificity: Recognizes BOLL.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BOLL antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: BOLL (NP_149019, 185aa-283aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BOLL expression in transfected 293T cell line by BOLL monoclonal antibody (M04), clone 1G8.Lane 1: BOLL transfected lysate(31.301 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged BOLL is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-BOLL antibody

This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-BOLL antibody

Antibodies; Spermatogenesis; Testis Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 14719414
• NCBI GeneID: 66037
• NCBI Accession #: NP_149019
• NCBI GenBank Nucleotide #: NM_033030
• UniProt Accession #: Q8N9W6; Q0JW32; Q53T62; Q969U3; B4DZA4
• Molecular Weight: 19,256 Da
• NCBI Official Full Name: protein boule-like isoform 2
• NCBI Official Synonym Full Names: boule-like RNA-binding protein
• NCBI Official Symbol: BOLL
• NCBI Official Synonym Symbols: BOULE
• NCBI Protein Information: protein boule-like; bol, boule-like
• UniProt Protein Name: Protein boule-like
• Protein Family: Protein boule
• UniProt Gene Name: BOLL
• UniProt Synonym Gene Names: BOULE
• UniProt Entry Name: BOLL_HUMAN

Uniprot Description

BOLL: Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation. Belongs to the RRM DAZ family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: cytoplasm

Molecular Function: protein binding; translation activator activity; RNA binding; nucleotide binding

Biological Process: positive regulation of translational initiation; meiosis; multicellular organismal development; spermatogenesis; cell differentiation