Mouse ERBB2 Monoclonal Antibody | anti-ERBB2 antibody

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (Biotin)

Cat. Num. AAA6171839

• Gene Names: ERBB2; NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: ERBB2; Monoclonal Antibody; ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2; neuro/glioblastoma Derived Oncogene Homolog (avian); CD340; HER-2; HER-2/neu; HER2; NEU; NGL; TKR1) (Biotin); v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2; TKR1; anti-ERBB2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C10
• Specificity: Recognizes ERBB2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ERBB2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ERBB2 (NP_004439, 22aa-121aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between PLCG2 and ERBB2 HeLa cells were stained with anti-PLCG2 rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ERBB2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ERBB2 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-ERBB2 antibody

This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq]

Product Categories/Family for anti-ERBB2 antibody

Antibodies; Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 54792096
• NCBI GeneID: 2064
• NCBI Accession #: NP_004439
• NCBI GenBank Nucleotide #: NM_004448.3
• UniProt Accession #: P04626; Q14256; Q6LDV1; Q9UMK4; B2RZG3; B4DHN3; X5D2V5
• Molecular Weight: 97,253 Da
• NCBI Official Full Name: receptor tyrosine-protein kinase erbB-2 isoform a
• NCBI Official Synonym Full Names: erb-b2 receptor tyrosine kinase 2
• NCBI Official Symbol: ERBB2
• NCBI Official Synonym Symbols: NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu
• NCBI Protein Information: receptor tyrosine-protein kinase erbB-2; herstatin; p185erbB2; proto-oncogene Neu; c-erb B2/neu protein; proto-oncogene c-ErbB-2; metastatic lymph node gene 19 protein; human epidermal growth factor receptor 2; neuro/glioblastoma derived oncogene homolog
• UniProt Protein Name: Receptor tyrosine-protein kinase erbB-2
• Protein Family: Receptor tyrosine-protein kinase
• UniProt Gene Name: ERBB2
• UniProt Synonym Gene Names: HER2; MLN19; NEU; NGL; MLN 19
• UniProt Entry Name: ERBB2_HUMAN

NCBI Description

This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

HER2: a proto-oncogenic receptor tyrosine kinase of the EGFR family. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. Not activated by EGF, TGF- alpha and amphiregulin. Amplified in breast cancer. Overexpression induces constitutive activity, and the gene is amplified or overexpressed in up to 30% of breast cancers, correlating with poor survival. The antibody Herceptin is approved for treatment of metastatic breast cancer with HER2 amplification/overexpression. Somatic mutations seen in 4% of lung cancers and also in breast, gastric, ovarian cancer and glioblastoma. One SNP shows predisposition to breast and gastric cancer. Inhibitors: Herceptin, lapatinib, PKI-166, EKB-569, CI-1033.

Protein type: Protein kinase, tyrosine (receptor); Kinase, protein; EC 2.7.10.1; Protein kinase, TK; Membrane protein, integral; Oncoprotein; TK group; EGFR family

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: perinuclear region of cytoplasm; basolateral plasma membrane; cytoplasm; apical plasma membrane; integral to membrane; plasma membrane; endosome membrane; cytoplasmic vesicle; nucleus; receptor complex

Molecular Function: protein dimerization activity; protein C-terminus binding; identical protein binding; protein binding; transmembrane receptor activity; ErbB-3 class receptor binding; protein heterodimerization activity; protein-tyrosine kinase activity; growth factor binding; transmembrane receptor protein tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; protein phosphatase binding; ATP binding

Biological Process: myelination; axon guidance; phosphoinositide 3-kinase cascade; peptidyl-tyrosine phosphorylation; positive regulation of cell adhesion; wound healing; nerve growth factor receptor signaling pathway; positive regulation of translation; heart development; protein amino acid autophosphorylation; motor axon guidance; signal transduction; enzyme linked receptor protein signaling pathway; protein amino acid phosphorylation; positive regulation of transcription from RNA polymerase I promoter; positive regulation of MAP kinase activity; cell surface receptor linked signal transduction; oligodendrocyte differentiation; neuromuscular junction development; epidermal growth factor receptor signaling pathway; negative regulation of immature T cell proliferation in the thymus; regulation of microtubule-based process; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; transcription, DNA-dependent; regulation of angiogenesis; positive regulation of cell growth; peripheral nervous system development; cell proliferation; positive regulation of transcription from RNA polymerase III promoter; innate immune response; positive regulation of protein amino acid phosphorylation; positive regulation of epithelial cell proliferation; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Gastric Cancer; Lung Cancer; Glioma Susceptibility 1