<
Testing Data
(Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1 ug/ml])
Mouse BUB1B Monoclonal Antibody | anti-BUB1B antibody
BUB1B (Budding Uninhibited by Benzimidazoles 1 Homolog beta (yeast), BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1) (Biotin)
Gene Names
BUB1B; MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
BUB1B; Monoclonal Antibody; BUB1B (Budding Uninhibited by Benzimidazoles 1 Homolog beta (yeast); BUB1beta; BUBR1; Bub1A; MAD3L; SSK1; hBUBR1) (Biotin); Budding Uninhibited by Benzimidazoles 1 Homolog beta (yeast); hBUBR1; anti-BUB1B antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G9
Specificity
Recognizes BUB1B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1050
Applicable Applications for anti-BUB1B antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BUB1B (AAH18739, 1aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1 ug/ml])
Testing Data
(Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BUB1B on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BUB1B on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BUB1B on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BUB1B on HeLa cell. [antibody concentration 10 ug/ml])
Western Blot (WB)
(BUB1B monoclonal antibody (M01), clone 2G9. Western Blot analysis of BUB1B expression in human spleen.)
Western Blot (WB)
(BUB1B monoclonal antibody (M01), clone 2G9. Western Blot analysis of BUB1B expression in human spleen.)
Related Product Information for anti-BUB1B antibody
This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq]
Product Categories/Family for anti-BUB1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Budding uninhibited by benzimidazoles 1 homolog beta (yeast)
NCBI Official Synonym Full Names
BUB1 mitotic checkpoint serine/threonine kinase B
NCBI Official Symbol
BUB1B
NCBI Official Synonym Symbols
MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
NCBI Protein Information
mitotic checkpoint serine/threonine-protein kinase BUB1 beta
Protein Family
NCBI Description
This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq, Jul 2008]
Research Articles on BUB1B
Similar Products
Product Notes
The BUB1B (Catalog #AAA6170992) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BUB1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BUB1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BUB1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
