Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HNRNPC expression in transfected 293T cell line by HNRNPC monoclonal antibody (M02), clone 4E8.Lane 1: HNRNPC transfected lysate (Predicted MW: 32.34 KDa).Lane 2: Non-transfected lysate.)

Mouse HNRNPC Monoclonal Antibody | anti-HNRNPC antibody

HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2), C1, C2, HNRNP, HNRPC, MGC104306, MGC105117, MGC117353, MGC131677, SNRPC) (APC)

Gene Names
HNRNPC; C1; C2; HNRNP; HNRPC; SNRPC
Applications
Western Blot
Purity
Purified
Synonyms
HNRNPC; Monoclonal Antibody; HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2); C1; C2; HNRNP; HNRPC; MGC104306; MGC105117; MGC117353; MGC131677; SNRPC) (APC); Heterogeneous Nuclear Ribonucleoprotein C (C1/C2); SNRPC; anti-HNRNPC antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
400000000
Specificity
Recognizes HNRNPC.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
250
Applicable Applications for anti-HNRNPC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HNRNPC (AAH89438.1, 1aa-250aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HNRNPC expression in transfected 293T cell line by HNRNPC monoclonal antibody (M02), clone 4E8.Lane 1: HNRNPC transfected lysate (Predicted MW: 32.34 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HNRNPC expression in transfected 293T cell line by HNRNPC monoclonal antibody (M02), clone 4E8.Lane 1: HNRNPC transfected lysate (Predicted MW: 32.34 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HNRNPC is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HNRNPC is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-HNRNPC antibody
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. [provided by RefSeq]
Product Categories/Family for anti-HNRNPC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
HNRPC protein
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein C
NCBI Official Symbol
HNRNPC
NCBI Official Synonym Symbols
C1; C2; HNRNP; HNRPC; SNRPC
NCBI Protein Information
heterogeneous nuclear ribonucleoproteins C1/C2

NCBI Description

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Research Articles on HNRNPC

Similar Products

Product Notes

The HNRNPC (Catalog #AAA6170106) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRNPC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HNRNPC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRNPC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.