Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DEAF1 monoclonal antibody (M11), clone 3C12. Western Blot analysis of DEAF1 expression in human liver.)

Mouse DEAF1 Monoclonal Antibody | anti-DEAF1 antibody

DEAF1 (Deformed Epidermal Autoregulatory Factor 1 (Drosophila), NUDR, SPN, ZMYND5) (APC)

Gene Names
DEAF1; SPN; NUDR; MRD24; ZMYND5
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DEAF1; Monoclonal Antibody; DEAF1 (Deformed Epidermal Autoregulatory Factor 1 (Drosophila); NUDR; SPN; ZMYND5) (APC); Deformed Epidermal Autoregulatory Factor 1 (Drosophila); ZMYND5; anti-DEAF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C12
Specificity
Recognizes DEAF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DEAF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DEAF1 (NP_066288.2, 133aa-222aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DEAF1 monoclonal antibody (M11), clone 3C12. Western Blot analysis of DEAF1 expression in human liver.)

Western Blot (WB) (DEAF1 monoclonal antibody (M11), clone 3C12. Western Blot analysis of DEAF1 expression in human liver.)
Related Product Information for anti-DEAF1 antibody
Mouse monoclonal antibody raised against a partial recombinant DEAF1.
Product Categories/Family for anti-DEAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,277 Da
NCBI Official Full Name
deformed epidermal autoregulatory factor 1 homolog isoform a
NCBI Official Synonym Full Names
DEAF1 transcription factor
NCBI Official Symbol
DEAF1
NCBI Official Synonym Symbols
SPN; NUDR; MRD24; ZMYND5
NCBI Protein Information
deformed epidermal autoregulatory factor 1 homolog; suppressin; zinc finger MYND domain-containing protein 5; nuclear DEAF-1-related transcriptional regulator
UniProt Protein Name
Deformed epidermal autoregulatory factor 1 homolog
UniProt Gene Name
DEAF1
UniProt Synonym Gene Names
SPN; ZMYND5; NUDR
UniProt Entry Name
DEAF1_HUMAN

NCBI Description

This gene encodes a zinc finger domain-containing protein that functions as a regulator of transcription. The encoded proteins binds to its own promoter as well as to that of several target genes. Activity of this protein is important in the regulation of embryonic development. Mutations in this gene have been found in individuals with autosomal dominant mental retardation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

DEAF1: a transcription factor that binds to its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE). Activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase.

Protein type: Transcription, coactivator/corepressor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleolus; extracellular region; nucleus

Molecular Function: protein binding; DNA binding; metal ion binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; regulation of mammary gland epithelial cell proliferation; anatomical structure morphogenesis; behavioral fear response; embryonic skeletal development; positive regulation of transcription, DNA-dependent; neural tube closure; visual learning; negative regulation of transcription, DNA-dependent; germ cell development

Disease: Mental Retardation, Autosomal Dominant 24

Research Articles on DEAF1

Similar Products

Product Notes

The DEAF1 deaf1 (Catalog #AAA6169032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DEAF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DEAF1 deaf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DEAF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.