<
Western Blot (WB)
(EEA1 monoclonal antibody (M03), clone 2G2. Western Blot analysis of EEA1 expression in A-431.)
Mouse EEA1 Monoclonal Antibody | anti-EEA1 antibody
EEA1 (Early endosome antigen 1, MST105, MSTP105, ZFYVE2) (APC)
Gene Names
EEA1; MST105; ZFYVE2; MSTP105
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
EEA1; Monoclonal Antibody; EEA1 (Early endosome antigen 1; MST105; MSTP105; ZFYVE2) (APC); Early endosome antigen 1; ZFYVE2; anti-EEA1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G2
Specificity
Recognizes EEA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EEA1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EEA1 (NP_003557, 1312aa-1411aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(EEA1 monoclonal antibody (M03), clone 2G2. Western Blot analysis of EEA1 expression in A-431.)
Western Blot (WB)
(EEA1 monoclonal antibody (M03), clone 2G2. Western Blot analysis of EEA1 expression in A-431.)
Testing Data
(Detection limit for recombinant GST tagged EEA1 is approximately 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged EEA1 is approximately 0.03ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EEA1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EEA1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EEA1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EEA1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-EEA1 antibody
Mouse monoclonal antibody raised against a partial recombinant EEA1.
Product Categories/Family for anti-EEA1 antibody
References
1. Flipping the Switch on Clathrin-Mediated Endocytosis using Thermally Responsive Protein Microdomains. Pastuszka MK, Okamoto CT, Hamm-Alvarez SF, Andrew MacKay J.Adv. Funct. Mater. doi: 10.1002/adfm.201400715
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
162,466 Da
NCBI Official Full Name
early endosome antigen 1
NCBI Official Synonym Full Names
early endosome antigen 1
NCBI Official Symbol
EEA1
NCBI Official Synonym Symbols
MST105; ZFYVE2; MSTP105
NCBI Protein Information
early endosome antigen 1; early endosome antigen 1, 162kD; early endosome-associated protein; endosome-associated protein p162; zinc finger FYVE domain-containing protein 2
UniProt Protein Name
Early endosome antigen 1
Protein Family
UniProt Gene Name
EEA1
UniProt Synonym Gene Names
ZFYVE2
UniProt Entry Name
EEA1_HUMAN
Similar Products
Product Notes
The EEA1 eea1 (Catalog #AAA6168311) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EEA1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EEA1 eea1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EEA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
