Mouse GTF2I Monoclonal Antibody | anti-GTF2I antibody

GTF2I (General Transcription Factor II, i, BAP-135, BAP135, BTKAP1, DIWS, FLJ38776, FLJ56355, IB291, SPIN, TFII-I, WBS, WBSCR6) (APC)

Cat. Num. AAA6166744

• Gene Names: GTF2I; WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: GTF2I; Monoclonal Antibody; GTF2I (General Transcription Factor II; i; BAP-135; BAP135; BTKAP1; DIWS; FLJ38776; FLJ56355; IB291; SPIN; TFII-I; WBS; WBSCR6) (APC); General Transcription Factor II; WBSCR6; anti-GTF2I antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D6
• Specificity: Recognizes GTF2I.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 274

• Applicable Applications for anti-GTF2I antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GTF2I (AAH04472.1, 36aa-274aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(GTF2I monoclonal antibody (M02), clone 2D6 Western Blot analysis of GTF2I expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged GTF2I is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-GTF2I antibody

This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21. [provided by RefSeq]

Product Categories/Family for anti-GTF2I antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 13325322
• NCBI GeneID: 2969
• NCBI Official Full Name: GTF2I protein
• NCBI Official Synonym Full Names: general transcription factor IIi
• NCBI Official Symbol: GTF2I
• NCBI Official Synonym Symbols: WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
• NCBI Protein Information: general transcription factor II-I
• Protein Family: General transcription factor

NCBI Description

This gene encodes a phosphoprotein containing six characteristic repeat motifs. The encoded protein binds to the initiator element (Inr) and E-box element in promoters and functions as a regulator of transcription. This locus, along with several other neighboring genes, is deleted in Williams-Beuren syndrome. There are many closely related genes and pseudogenes for this gene on chromosome 7. This gene also has pseudogenes on chromosomes 9, 13, and 21. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2013]