Mouse anti-Human GTF2I Monoclonal Antibody | anti-GTF2I antibody

GTF2I (BAP135, WBSCR6, General Transcription Factor II-I, Bruton Tyrosine Kinase-associated Protein 135, SRF-Phox1-interacting Protein, Williams-Beuren Syndrome Chromosomal Region 6 Protein)

Cat. Num. AAA6000051

• Gene Names: GTF2I; WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GTF2I; Monoclonal Antibody; GTF2I (BAP135; WBSCR6; General Transcription Factor II-I; Bruton Tyrosine Kinase-associated Protein 135; SRF-Phox1-interacting Protein; Williams-Beuren Syndrome Chromosomal Region 6 Protein); Anti -GTF2I (BAP135; anti-GTF2I antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E2
• Specificity: Recognizes human GTF2I.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG

• Applicable Applications for anti-GTF2I antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length recombinant corresponding to aa36-274 from human GTF2I (AAH04472.1) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.03kD).)

Western Blot (WB)

(GTF2I monoclonal antibody. Western Blot analysis of GTF2I expression in human colon.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell . [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged GTF2I is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-GTF2I antibody

This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21.

Product Categories/Family for anti-GTF2I antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 14670350
• NCBI GeneID: 2969
• NCBI Accession #: NP_127492.1
• NCBI GenBank Nucleotide #: NM_032999.3
• UniProt Accession #: P78347; O14743; O15359; O43546; O43588; O43589; Q75M85; Q75M86; Q75M87; Q75M88; Q9BSZ4
• Molecular Weight: 112,416 Da
• NCBI Official Full Name: general transcription factor II-I isoform 1
• NCBI Official Synonym Full Names: general transcription factor IIi
• NCBI Official Symbol: GTF2I
• NCBI Official Synonym Symbols: WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
• NCBI Protein Information: general transcription factor II-I; BTK-associated protein, 135kD; SRF-Phox1-interacting protein; Williams-Beuren syndrome chromosome region 6; Bruton tyrosine kinase-associated protein 135
• UniProt Protein Name: General transcription factor II-I
• Protein Family: General transcription factor
• UniProt Gene Name: GTF2I
• UniProt Synonym Gene Names: BAP135; WBSCR6; GTFII-I; TFII-I; BAP-135; BTK-associated protein 135; SPIN
• UniProt Entry Name: GTF2I_HUMAN

NCBI Description

This gene encodes a phosphoprotein containing six characteristic repeat motifs. The encoded protein binds to the initiator element (Inr) and E-box element in promoters and functions as a regulator of transcription. This locus, along with several other neighboring genes, is deleted in Williams-Beuren syndrome. There are many closely related genes and pseudogenes for this gene on chromosome 7. This gene also has pseudogenes on chromosomes 9, 13, and 21. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2013]

Uniprot Description

GTF2I: a multifunctional phosphoprotein with roles in transcription and signal transduction. Interacts with the basal transcription machinery by coordinating the formation of a multiprotein complex at the C-FOS promoter, and linking specific signal responsive activator complexes. Promotes the formation of stable high-order complexes of SRF and Phox1 and interacts cooperatively with Phox1 to promote serum-inducible transcription of a reporter gene driven by the C- FOS serum response element (SRE). Acts as a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box. Its gene is known to contain at least 34 exons. Four splice variant isoforms have been described.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: nucleoplasm; cell projection; cell soma; membrane; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; mitogen-activated protein kinase binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; negative regulation of angiogenesis; regulation of transcription, DNA-dependent; reduction of cytosolic calcium ion concentration; transition between slow and fast fiber; signal transduction

Disease: Williams-beuren Syndrome