Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged COX4NB is 0.3 ng/ml as a capture antibody.)

Mouse COX4NB Monoclonal Antibody | anti-COX4NB antibody

COX4NB (COX4 neighbor, C16orf2, C16orf4, FAM158B, NOC4) (AP)

Gene Names
EMC8; NOC4; COX4NB; C16orf2; C16orf4; FAM158B
Applications
Western Blot
Purity
Purified
Synonyms
COX4NB; Monoclonal Antibody; COX4NB (COX4 neighbor; C16orf2; C16orf4; FAM158B; NOC4) (AP); COX4 neighbor; NOC4; anti-COX4NB antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes COX4NB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-COX4NB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
COX4NB (NP_006058.1, 113aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged COX4NB is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged COX4NB is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of COX4NB expression in transfected 293T cell line by COX4NB monoclonal antibody (M01), clone 4F4.Lane 1: COX4NB transfected lysate (Predicted MW: 23.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of COX4NB expression in transfected 293T cell line by COX4NB monoclonal antibody (M01), clone 4F4.Lane 1: COX4NB transfected lysate (Predicted MW: 23.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(COX4NB monoclonal antibody (M01), clone 4F4. Western Blot analysis of COX4NB expression in HeLa.)

Western Blot (WB) (COX4NB monoclonal antibody (M01), clone 4F4. Western Blot analysis of COX4NB expression in HeLa.)
Related Product Information for anti-COX4NB antibody
Mouse monoclonal antibody raised against a partial recombinant COX4NB.
Product Categories/Family for anti-COX4NB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,726 Da
NCBI Official Full Name
Homo sapiens ER membrane protein complex subunit 8 (EMC8), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ER membrane protein complex subunit 8
NCBI Official Symbol
EMC8
NCBI Official Synonym Symbols
NOC4; COX4NB; C16orf2; C16orf4; FAM158B
NCBI Protein Information
ER membrane protein complex subunit 8; COX4 neighbor; family with sequence similarity 158, member B; neighbor of COX4

Research Articles on COX4NB

Similar Products

Product Notes

The COX4NB (Catalog #AAA6165812) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COX4NB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COX4NB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COX4NB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.