Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Mouse TYMS Monoclonal Antibody | anti-TYMS antibody

TYMS (Thymidylate Synthetase, HsT422, MGC88736, TMS, TS, TSase) (AP)

Gene Names
TYMS; TS; TMS; HST422
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TYMS; Monoclonal Antibody; TYMS (Thymidylate Synthetase; HsT422; MGC88736; TMS; TS; TSase) (AP); Thymidylate Synthetase; TSase; anti-TYMS antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B2
Specificity
Recognizes TYMS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
313
Applicable Applications for anti-TYMS antibody
ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TYMS (AAH13919, 111aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml])

Western Blot (WB)

(Western Blot analysis of TYMS expression in transfected 293T cell line by TYMS monoclonal antibody (M02), clone 2B2.Lane 1: TYMS transfected lysate(35.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TYMS expression in transfected 293T cell line by TYMS monoclonal antibody (M02), clone 2B2.Lane 1: TYMS transfected lysate(35.7 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of TYMS transfected lysate using anti-TYMS monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TYMS MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of TYMS transfected lysate using anti-TYMS monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TYMS MaxPab rabbit polyclonal antibody.)
Product Categories/Family for anti-TYMS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Thymidylate synthetase
NCBI Official Synonym Full Names
thymidylate synthetase
NCBI Official Symbol
TYMS
NCBI Official Synonym Symbols
TS; TMS; HST422
NCBI Protein Information
thymidylate synthase

NCBI Description

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. [provided by RefSeq, Aug 2017]

Research Articles on TYMS

Similar Products

Product Notes

The TYMS (Catalog #AAA6165104) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TYMS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TYMS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TYMS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.