Mouse PMM2 Monoclonal Antibody | anti-PMM2 antibody

PMM2 (phosphomannomutase 2, CDG1, CDG1a, CDGS) (AP)

Cat. Num. AAA6164681

• Gene Names: PMM2; PMI; CDG1; CDGS; PMI1; CDG1a; PMM 2
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: PMM2; Monoclonal Antibody; PMM2 (phosphomannomutase 2; CDG1; CDG1a; CDGS) (AP); phosphomannomutase 2; CDGS; anti-PMM2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2A5
• Specificity: Recognizes PMM2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PMM2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PMM2 (AAH08310, 1aa-246aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PMM2 monoclonal antibody (M02), clone 2A5. Western Blot analysis of PMM2 expression in K-562.)

Related Product Information for anti-PMM2 antibody

The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq]

Product Categories/Family for anti-PMM2 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 14249868
• NCBI GeneID: 5373
• Molecular Weight: 13,428 Da
• NCBI Official Full Name: Phosphomannomutase 2
• NCBI Official Synonym Full Names: phosphomannomutase 2
• NCBI Official Symbol: PMM2
• NCBI Official Synonym Symbols: PMI; CDG1; CDGS; PMI1; CDG1a; PMM 2
• NCBI Protein Information: phosphomannomutase 2
• Protein Family: Phosphomannomutase

NCBI Description

The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq, Jul 2008]