Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DDX54 monoclonal antibody (M03), clone 5B3 Western Blot analysis of DDX54 expression in A-431.)

Mouse DDX54 Monoclonal Antibody | anti-DDX54 antibody

DDX54 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 54, DP97, MGC2835) (AP)

Gene Names
DDX54; DP97
Applications
Western Blot
Purity
Purified
Synonyms
DDX54; Monoclonal Antibody; DDX54 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 54; DP97; MGC2835) (AP); DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 54; MGC2835; anti-DDX54 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B3
Specificity
Recognizes DDX54.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DDX54 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DDX54 (NP_076977, 778aa-881aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DDX54 monoclonal antibody (M03), clone 5B3 Western Blot analysis of DDX54 expression in A-431.)

Western Blot (WB) (DDX54 monoclonal antibody (M03), clone 5B3 Western Blot analysis of DDX54 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged DDX54 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DDX54 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DDX54 antibody
This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-DDX54 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
ATP-dependent RNA helicase DDX54 isoform 2
NCBI Official Synonym Full Names
DEAD-box helicase 54
NCBI Official Symbol
DDX54
NCBI Official Synonym Symbols
DP97
NCBI Protein Information
ATP-dependent RNA helicase DDX54
UniProt Protein Name
ATP-dependent RNA helicase DDX54
UniProt Gene Name
DDX54
UniProt Entry Name
DDX54_HUMAN

NCBI Description

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DDX54: Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors. Belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; EC 3.6.4.13; Helicase; RNA processing; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: membrane; nucleolus; nucleus

Molecular Function: estrogen receptor binding; transcription corepressor activity; ATP binding; ATP-dependent RNA helicase activity; receptor binding

Biological Process: RNA processing; estrogen receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA metabolic process

Research Articles on DDX54

Similar Products

Product Notes

The DDX54 ddx54 (Catalog #AAA6163534) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DDX54 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDX54 ddx54 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX54, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.