Mouse DDX54 Monoclonal Antibody | anti-DDX54 antibody

DDX54 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 54, DP97, MGC2835) (AP)

Cat. Num. AAA6163534

• Gene Names: DDX54; DP97
• Applications: Western Blot
• Purity: Purified
• Synonyms: DDX54; Monoclonal Antibody; DDX54 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 54; DP97; MGC2835) (AP); DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 54; MGC2835; anti-DDX54 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5B3
• Specificity: Recognizes DDX54.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-DDX54 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DDX54 (NP_076977, 778aa-881aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DDX54 monoclonal antibody (M03), clone 5B3 Western Blot analysis of DDX54 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged DDX54 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-DDX54 antibody

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-DDX54 antibody

Antibodies; DEAD Box Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 51094101
• NCBI GeneID: 79039
• NCBI Accession #: NP_076977
• NCBI GenBank Nucleotide #: NM_024072
• UniProt Accession #: Q8TDD1
• Molecular Weight: 97kDa
• NCBI Official Full Name: ATP-dependent RNA helicase DDX54 isoform 2
• NCBI Official Synonym Full Names: DEAD-box helicase 54
• NCBI Official Symbol: DDX54
• NCBI Official Synonym Symbols: DP97
• NCBI Protein Information: ATP-dependent RNA helicase DDX54
• UniProt Protein Name: ATP-dependent RNA helicase DDX54
• Protein Family: ATP-dependent RNA helicase
• UniProt Gene Name: DDX54
• UniProt Entry Name: DDX54_HUMAN

NCBI Description

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DDX54: Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors. Belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; EC 3.6.4.13; Helicase; RNA processing; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: membrane; nucleolus; nucleus

Molecular Function: estrogen receptor binding; transcription corepressor activity; ATP binding; ATP-dependent RNA helicase activity; receptor binding

Biological Process: RNA processing; estrogen receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA metabolic process